Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2139631..2139930 | Replicon | chromosome |
Accession | NZ_CP007176 | ||
Organism | Staphylococcus aureus USA300-ISMMS1 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | AZ30_RS15770 | Protein ID | WP_011447039.1 |
Coordinates | 2139754..2139930 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2139631..2139686 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AZ30_RS10845 | 2134962..2135222 | + | 261 | WP_001791826.1 | hypothetical protein | - |
AZ30_RS10850 | 2135275..2135625 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
AZ30_RS10855 | 2136310..2136759 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
AZ30_RS16115 | 2136854..2137189 | - | 336 | Protein_2065 | SH3 domain-containing protein | - |
AZ30_RS10865 | 2137839..2138330 | - | 492 | WP_000919350.1 | staphylokinase | - |
AZ30_RS10870 | 2138521..2139276 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
AZ30_RS10875 | 2139288..2139542 | - | 255 | WP_000611512.1 | phage holin | - |
AZ30_RS10880 | 2139594..2139701 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2139623..2139762 | + | 140 | NuclAT_0 | - | - |
- | 2139623..2139762 | + | 140 | NuclAT_0 | - | - |
- | 2139623..2139762 | + | 140 | NuclAT_0 | - | - |
- | 2139623..2139762 | + | 140 | NuclAT_0 | - | - |
- | 2139631..2139686 | + | 56 | - | - | Antitoxin |
AZ30_RS15770 | 2139754..2139930 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
AZ30_RS10890 | 2140080..2140376 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
AZ30_RS10895 | 2140434..2140721 | - | 288 | WP_001040261.1 | hypothetical protein | - |
AZ30_RS10900 | 2140768..2140920 | - | 153 | WP_001153681.1 | hypothetical protein | - |
AZ30_RS10905 | 2140910..2144695 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2135275..2194243 | 58968 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T46138 WP_011447039.1 NZ_CP007176:c2139930-2139754 [Staphylococcus aureus USA300-ISMMS1]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T46138 NZ_CP007176:c2139930-2139754 [Staphylococcus aureus USA300-ISMMS1]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT46138 NZ_CP007176:2139631-2139686 [Staphylococcus aureus USA300-ISMMS1]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|