Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1935632..1935814 | Replicon | chromosome |
| Accession | NZ_CP007176 | ||
| Organism | Staphylococcus aureus USA300-ISMMS1 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | AZ30_RS16085 | Protein ID | WP_001801861.1 |
| Coordinates | 1935632..1935727 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1935755..1935814 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AZ30_RS09565 | 1931292..1931918 | + | 627 | Protein_1841 | hypothetical protein | - |
| AZ30_RS09570 | 1931959..1932303 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| AZ30_RS09575 | 1932401..1932952 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| AZ30_RS09580 | 1933170..1933811 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| AZ30_RS09585 | 1933925..1934110 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| AZ30_RS09590 | 1934112..1934288 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| AZ30_RS09595 | 1934299..1934682 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| AZ30_RS09605 | 1935286..1935429 | - | 144 | WP_001549059.1 | transposase | - |
| AZ30_RS16085 | 1935632..1935727 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1935755..1935814 | - | 60 | - | - | Antitoxin |
| AZ30_RS09610 | 1935850..1935951 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| AZ30_RS15685 | 1935929..1936105 | - | 177 | Protein_1851 | transposase | - |
| AZ30_RS09615 | 1936299..1936676 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T46135 WP_001801861.1 NZ_CP007176:1935632-1935727 [Staphylococcus aureus USA300-ISMMS1]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T46135 NZ_CP007176:1935632-1935727 [Staphylococcus aureus USA300-ISMMS1]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT46135 NZ_CP007176:c1935814-1935755 [Staphylococcus aureus USA300-ISMMS1]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|