Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2453545..2453770 Replicon chromosome
Accession NZ_CP007133
Organism Escherichia coli O145:H28 str. RM12761

Toxin (Protein)


Gene name hokW Uniprot ID A0A1Q4PF16
Locus tag ECRM12761_RS12635 Protein ID WP_000813258.1
Coordinates 2453545..2453700 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2453712..2453770 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECRM12761_RS12585 2448546..2448977 - 432 WP_025380440.1 tellurite resistance TerB family protein -
ECRM12761_RS12600 2449428..2450141 - 714 WP_144319765.1 helix-turn-helix domain-containing protein -
ECRM12761_RS32275 2450279..2450476 - 198 WP_000917764.1 hypothetical protein -
ECRM12761_RS12610 2450701..2451255 - 555 WP_000640035.1 DUF1133 family protein -
ECRM12761_RS12615 2451264..2451623 - 360 WP_025380442.1 RusA family crossover junction endodeoxyribonuclease -
ECRM12761_RS12620 2451636..2452685 - 1050 WP_001265229.1 DUF968 domain-containing protein -
ECRM12761_RS12625 2452687..2452959 - 273 WP_000191872.1 hypothetical protein -
ECRM12761_RS12630 2453081..2453425 - 345 WP_000756596.1 YgiW/YdeI family stress tolerance OB fold protein -
ECRM12761_RS12635 2453545..2453700 - 156 WP_000813258.1 type I toxin-antitoxin system Hok family toxin Toxin
- 2453712..2453770 + 59 - - Antitoxin
ECRM12761_RS12640 2453991..2454548 - 558 WP_000104474.1 DUF551 domain-containing protein -
ECRM12761_RS12645 2454550..2454768 - 219 WP_000683609.1 DUF4014 family protein -
ECRM12761_RS12650 2454896..2455207 - 312 WP_000034815.1 hypothetical protein -
ECRM12761_RS12655 2455200..2455427 - 228 WP_000699809.1 hypothetical protein -
ECRM12761_RS12660 2455424..2455705 - 282 WP_042353845.1 DNA-binding protein -
ECRM12761_RS32280 2455738..2456454 - 717 WP_000450617.1 DUF1627 domain-containing protein -
ECRM12761_RS32285 2456476..2457222 - 747 WP_025380443.1 ATP-binding protein -
ECRM12761_RS12675 2457229..2458335 - 1107 WP_025380444.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - nleF / nleH2 / nleC / nleB2 2404620..2478317 73697


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5767.95 Da        Isoelectric Point: 7.7942

>T46051 WP_000813258.1 NZ_CP007133:c2453700-2453545 [Escherichia coli O145:H28 str. RM12761]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK

Download         Length: 156 bp

>T46051 NZ_CP007133:c2453700-2453545 [Escherichia coli O145:H28 str. RM12761]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA

Antitoxin


Download         Length: 59 bp

>AT46051 NZ_CP007133:2453712-2453770 [Escherichia coli O145:H28 str. RM12761]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1Q4PF16

Antitoxin

Download structure file

References