Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2046163..2046388 | Replicon | chromosome |
Accession | NZ_CP007037 | ||
Organism | Shigella flexneri G1663 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | SF2A_RS11440 | Protein ID | WP_000813254.1 |
Coordinates | 2046163..2046318 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2046330..2046388 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SF2A_RS11385 | 2041475..2041825 | - | 351 | WP_005049241.1 | IS66 family insertion sequence element accessory protein TnpB | - |
SF2A_RS11390 | 2041822..2042496 | - | 675 | WP_004967157.1 | IS66-like element accessory protein TnpA | - |
SF2A_RS11395 | 2042595..2042810 | - | 216 | WP_000839572.1 | class II holin family protein | - |
SF2A_RS11420 | 2043606..2044294 | - | 689 | Protein_2077 | bacteriophage antitermination protein Q | - |
SF2A_RS11425 | 2044291..2044656 | - | 366 | WP_000140020.1 | RusA family crossover junction endodeoxyribonuclease | - |
SF2A_RS11430 | 2044657..2045715 | - | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
SF2A_RS27665 | 2045717..2045995 | - | 279 | WP_011069426.1 | hypothetical protein | - |
SF2A_RS11440 | 2046163..2046318 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 2046330..2046388 | + | 59 | - | - | Antitoxin |
SF2A_RS11450 | 2046970..2047386 | - | 417 | WP_005069274.1 | hypothetical protein | - |
SF2A_RS11455 | 2047413..2047553 | + | 141 | Protein_2083 | DUF4224 domain-containing protein | - |
SF2A_RS11460 | 2047553..2048590 | + | 1038 | WP_004974968.1 | tyrosine-type recombinase/integrase | - |
SF2A_RS11470 | 2048801..2049598 | + | 798 | WP_001325918.1 | DgsA anti-repressor MtfA | - |
SF2A_RS11480 | 2049936..2051198 | + | 1263 | Protein_2086 | tyrosine-type recombinase/integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | ipaH9.8 | 2014313..2054506 | 40193 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T45984 WP_000813254.1 NZ_CP007037:c2046318-2046163 [Shigella flexneri G1663]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T45984 NZ_CP007037:c2046318-2046163 [Shigella flexneri G1663]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT45984 NZ_CP007037:2046330-2046388 [Shigella flexneri G1663]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|