Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1381788..1382013 | Replicon | chromosome |
Accession | NZ_CP007037 | ||
Organism | Shigella flexneri G1663 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | SF2A_RS07485 | Protein ID | WP_000813254.1 |
Coordinates | 1381858..1382013 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1381788..1381846 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SF2A_RS30755 | 1377786..1377955 | + | 170 | Protein_1364 | hypothetical protein | - |
SF2A_RS07445 | 1378101..1378847 | + | 747 | WP_000788998.1 | ATP-binding protein | - |
SF2A_RS07450 | 1378862..1379284 | + | 423 | WP_001118167.1 | DUF977 family protein | - |
SF2A_RS07455 | 1379342..1379698 | + | 357 | WP_005048249.1 | hypothetical protein | - |
SF2A_RS07460 | 1379791..1380009 | + | 219 | WP_000256998.1 | DUF4014 family protein | - |
SF2A_RS07465 | 1380011..1380376 | + | 366 | WP_001229298.1 | HNH endonuclease signature motif containing protein | - |
SF2A_RS07470 | 1380373..1381038 | + | 666 | WP_000208062.1 | hypothetical protein | - |
SF2A_RS07475 | 1381038..1381403 | + | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
- | 1381788..1381846 | - | 59 | - | - | Antitoxin |
SF2A_RS07485 | 1381858..1382013 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
SF2A_RS27075 | 1382519..1383203 | - | 685 | Protein_1373 | IS1 family transposase | - |
SF2A_RS07505 | 1383337..1383936 | + | 600 | WP_000940329.1 | DUF1367 family protein | - |
SF2A_RS07510 | 1383936..1384226 | + | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
SF2A_RS07515 | 1384223..1384777 | + | 555 | WP_000640143.1 | DUF1133 family protein | - |
SF2A_RS07520 | 1384930..1385103 | + | 174 | WP_000504450.1 | hypothetical protein | - |
SF2A_RS27085 | 1385165..1386321 | + | 1157 | WP_094081550.1 | IS3-like element IS600 family transposase | - |
SF2A_RS07535 | 1386392..1386874 | + | 483 | WP_000068107.1 | ORF6N domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | sitABCD | ipaH9.8 | 1345139..1435284 | 90145 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T45973 WP_000813254.1 NZ_CP007037:1381858-1382013 [Shigella flexneri G1663]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T45973 NZ_CP007037:1381858-1382013 [Shigella flexneri G1663]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT45973 NZ_CP007037:c1381846-1381788 [Shigella flexneri G1663]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|