Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 57743..58169 | Replicon | plasmid p3PCN033 |
| Accession | NZ_CP006635 | ||
| Organism | Escherichia coli PCN033 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | PPECC33_RS24945 | Protein ID | WP_001312861.1 |
| Coordinates | 57743..57901 (-) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 57945..58169 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PPECC33_RS24910 | 53117..53806 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| PPECC33_RS24915 | 53993..54376 | - | 384 | WP_001151524.1 | relaxosome protein TraM | - |
| PPECC33_RS24920 | 54697..55299 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| PPECC33_RS24925 | 55596..56417 | - | 822 | WP_001234426.1 | DUF945 domain-containing protein | - |
| PPECC33_RS24930 | 56535..56822 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| PPECC33_RS24945 | 57743..57901 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 57945..58169 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 57945..58169 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 57945..58169 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 57945..58169 | - | 225 | NuclAT_0 | - | Antitoxin |
| PPECC33_RS28820 | 57981..58169 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| PPECC33_RS24955 | 58181..58900 | - | 720 | WP_001276238.1 | plasmid SOS inhibition protein A | - |
| PPECC33_RS24960 | 58897..59331 | - | 435 | WP_000845936.1 | conjugation system SOS inhibitor PsiB | - |
| PPECC33_RS27265 | 59386..59583 | - | 198 | Protein_74 | hypothetical protein | - |
| PPECC33_RS24965 | 59611..59844 | - | 234 | WP_000005987.1 | DUF905 family protein | - |
| PPECC33_RS24970 | 59912..60451 | - | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
| PPECC33_RS29015 | 60477..60683 | - | 207 | WP_000275856.1 | hypothetical protein | - |
| PPECC33_RS24985 | 61822..62793 | - | 972 | WP_000817028.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 / sitABCD / oqxA / oqxB / blaTEM-1B / tet(B) | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN | 1..161511 | 161511 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T45325 WP_001312861.1 NZ_CP006635:c57901-57743 [Escherichia coli PCN033]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T45325 NZ_CP006635:c57901-57743 [Escherichia coli PCN033]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 225 bp
>AT45325 NZ_CP006635:c58169-57945 [Escherichia coli PCN033]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|