Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2484785..2484969 | Replicon | chromosome |
Accession | NZ_CP006630 | ||
Organism | Staphylococcus aureus subsp. aureus SA268 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | SA268_RS12645 | Protein ID | WP_000482647.1 |
Coordinates | 2484862..2484969 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2484785..2484845 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SA268_RS12625 | 2480295..2480462 | - | 168 | WP_031845053.1 | hypothetical protein | - |
SA268_RS12635 | 2480693..2482426 | - | 1734 | WP_000488493.1 | ABC transporter ATP-binding protein/permease | - |
SA268_RS12640 | 2482502..2484214 | - | 1713 | WP_001064821.1 | ABC transporter ATP-binding protein/permease | - |
- | 2484785..2484845 | + | 61 | - | - | Antitoxin |
SA268_RS12645 | 2484862..2484969 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SA268_RS12650 | 2485102..2485488 | - | 387 | WP_000779353.1 | flippase GtxA | - |
SA268_RS12655 | 2485756..2486898 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
SA268_RS12660 | 2486958..2487617 | + | 660 | WP_000831298.1 | membrane protein | - |
SA268_RS12665 | 2487800..2489011 | + | 1212 | WP_001191921.1 | multidrug effflux MFS transporter | - |
SA268_RS12670 | 2489134..2489607 | - | 474 | WP_000456483.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T45292 WP_000482647.1 NZ_CP006630:c2484969-2484862 [Staphylococcus aureus subsp. aureus SA268]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T45292 NZ_CP006630:c2484969-2484862 [Staphylococcus aureus subsp. aureus SA268]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT45292 NZ_CP006630:2484785-2484845 [Staphylococcus aureus subsp. aureus SA268]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|