Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1420012..1420237 | Replicon | chromosome |
Accession | NZ_CP004056 | ||
Organism | Shigella flexneri 2003036 isolate Human |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | SFY_RS07730 | Protein ID | WP_000018421.1 |
Coordinates | 1420025..1420237 (+) | Length | 71 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1420012..1420070 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SFY_RS29250 | 1415578..1415832 | + | 255 | Protein_1387 | hypothetical protein | - |
SFY_RS07690 | 1416325..1417071 | + | 747 | WP_000788996.1 | ATP-binding protein | - |
SFY_RS07695 | 1417086..1417508 | + | 423 | WP_001118168.1 | DUF977 family protein | - |
SFY_RS07700 | 1417566..1417922 | + | 357 | WP_005048249.1 | hypothetical protein | - |
SFY_RS07705 | 1418015..1418233 | + | 219 | WP_000256998.1 | DUF4014 family protein | - |
SFY_RS07710 | 1418235..1418600 | + | 366 | WP_001229297.1 | HNH endonuclease | - |
SFY_RS07715 | 1418597..1419262 | + | 666 | WP_000208062.1 | hypothetical protein | - |
SFY_RS07720 | 1419262..1419627 | + | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
- | 1420012..1420070 | - | 59 | - | - | Antitoxin |
SFY_RS07730 | 1420025..1420237 | + | 213 | WP_000018421.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
SFY_RS07740 | 1420743..1421440 | - | 698 | Protein_1396 | IS1 family transposase | - |
SFY_RS07750 | 1421574..1422173 | + | 600 | WP_000940329.1 | DUF1367 family protein | - |
SFY_RS07755 | 1422173..1422463 | + | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
SFY_RS07760 | 1422460..1423014 | + | 555 | WP_000640143.1 | DUF1133 family protein | - |
SFY_RS27760 | 1423155..1423340 | + | 186 | WP_005049799.1 | hypothetical protein | - |
SFY_RS07775 | 1423402..1424558 | + | 1157 | WP_094081518.1 | IS3 family transposase | - |
SFY_RS07780 | 1424586..1424954 | + | 369 | WP_011069357.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | sitABCD | ipaH9.8 / ipaH9.8 | 1412095..1466976 | 54881 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 71 a.a. Molecular weight: 7880.44 Da Isoelectric Point: 9.2663
>T44917 WP_000018421.1 NZ_CP004056:1420025-1420237 [Shigella flexneri 2003036]
MSHKCRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MSHKCRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 213 bp
>T44917 NZ_CP004056:1420025-1420237 [Shigella flexneri 2003036]
ATGTCTCACAAATGTAGGTTAGCCTCTTACGTGCCGAAAGGCAAGGAGAAGCAGGCTATGAAGCAGCAAAAGGCGATGTT
AATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAAAGACCTCTGCGAGGTACGAATCC
GAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGTCTCACAAATGTAGGTTAGCCTCTTACGTGCCGAAAGGCAAGGAGAAGCAGGCTATGAAGCAGCAAAAGGCGATGTT
AATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAAAGACCTCTGCGAGGTACGAATCC
GAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT44917 NZ_CP004056:c1420070-1420012 [Shigella flexneri 2003036]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|