Detailed information of TA system TA044532

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 22615..22884
• Replicon: plasmid pJNE132847_2
• Accession: NZ_AP028096
• Organism: Escherichia coli strain JNE132847

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: JE76HU_RS26875
• Protein ID: WP_001372321.1
• Coordinates: 22759..22884 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	22615..22680 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
JE76HU_RS26840	17662..18105	-	444	Protein_24	hypothetical protein	-
JE76HU_RS26845	18407..18934	+	528	WP_134888794.1	single-stranded DNA-binding protein	-
JE76HU_RS26850	18991..19224	+	234	WP_113334342.1	DUF905 domain-containing protein	-
JE76HU_RS26855	19283..21241	+	1959	WP_286352596.1	ParB/RepB/Spo0J family partition protein	-
JE76HU_RS26860	21296..21730	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
JE76HU_RS26865	21727..22489	+	763	Protein_29	plasmid SOS inhibition protein A	-
-	22458..22682	+	225	NuclAT_0	-	-
-	22458..22682	+	225	NuclAT_0	-	-
-	22458..22682	+	225	NuclAT_0	-	-
-	22458..22682	+	225	NuclAT_0	-	-
-	22615..22680	+	66	-	-	Antitoxin
JE76HU_RS26870	22668..22817	+	150	Protein_30	plasmid maintenance protein Mok	-
JE76HU_RS26875	22759..22884	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
JE76HU_RS26880	23185..23481	-	297	Protein_32	hypothetical protein	-
JE76HU_RS26885	23781..24077	+	297	WP_001272251.1	hypothetical protein	-
JE76HU_RS26890	24188..25009	+	822	WP_001234445.1	DUF932 domain-containing protein	-
JE76HU_RS26895	25306..25908	-	603	WP_000243713.1	transglycosylase SLT domain-containing protein	-
JE76HU_RS26900	26231..26614	+	384	WP_001354030.1	conjugal transfer relaxosome DNA-binding protein TraM	-
JE76HU_RS26905	26808..27479	+	672	WP_000283561.1	conjugal transfer transcriptional regulator TraJ	-
JE76HU_RS26910	27616..27843	+	228	WP_000089263.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	mph(A) / blaTEM-1B	-	1..75901	75901

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T44532 WP_001372321.1 NZ_AP028096:22759-22884 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T44532 NZ_AP028096:22759-22884 [Escherichia coli]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT44532 NZ_AP028096:22615-22680 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC

Structures

Antitoxin