Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1432376..1432596 Replicon chromosome
Accession NZ_AP028094
Organism Escherichia coli strain JNE132847

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag JE76HU_RS07120 Protein ID WP_000170965.1
Coordinates 1432376..1432483 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1432530..1432596 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JE76HU_RS07090 1428231..1429064 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
JE76HU_RS07095 1429061..1429453 + 393 WP_137549514.1 invasion regulator SirB2 -
JE76HU_RS07100 1429457..1430266 + 810 WP_001257044.1 invasion regulator SirB1 -
JE76HU_RS07105 1430302..1431156 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
JE76HU_RS07110 1431305..1431412 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1431460..1431526 + 67 NuclAT_44 - -
- 1431460..1431526 + 67 NuclAT_44 - -
- 1431460..1431526 + 67 NuclAT_44 - -
- 1431460..1431526 + 67 NuclAT_44 - -
- 1431460..1431526 + 67 NuclAT_47 - -
- 1431460..1431526 + 67 NuclAT_47 - -
- 1431460..1431526 + 67 NuclAT_47 - -
- 1431460..1431526 + 67 NuclAT_47 - -
- 1431460..1431526 + 67 NuclAT_50 - -
- 1431460..1431526 + 67 NuclAT_50 - -
- 1431460..1431526 + 67 NuclAT_50 - -
- 1431460..1431526 + 67 NuclAT_50 - -
- 1431462..1431525 + 64 NuclAT_16 - -
- 1431462..1431525 + 64 NuclAT_16 - -
- 1431462..1431525 + 64 NuclAT_16 - -
- 1431462..1431525 + 64 NuclAT_16 - -
- 1431462..1431525 + 64 NuclAT_19 - -
- 1431462..1431525 + 64 NuclAT_19 - -
- 1431462..1431525 + 64 NuclAT_19 - -
- 1431462..1431525 + 64 NuclAT_19 - -
- 1431462..1431525 + 64 NuclAT_22 - -
- 1431462..1431525 + 64 NuclAT_22 - -
- 1431462..1431525 + 64 NuclAT_22 - -
- 1431462..1431525 + 64 NuclAT_22 - -
- 1431462..1431525 + 64 NuclAT_25 - -
- 1431462..1431525 + 64 NuclAT_25 - -
- 1431462..1431525 + 64 NuclAT_25 - -
- 1431462..1431525 + 64 NuclAT_25 - -
- 1431462..1431525 + 64 NuclAT_28 - -
- 1431462..1431525 + 64 NuclAT_28 - -
- 1431462..1431525 + 64 NuclAT_28 - -
- 1431462..1431525 + 64 NuclAT_28 - -
- 1431462..1431525 + 64 NuclAT_31 - -
- 1431462..1431525 + 64 NuclAT_31 - -
- 1431462..1431525 + 64 NuclAT_31 - -
- 1431462..1431525 + 64 NuclAT_31 - -
JE76HU_RS07115 1431840..1431947 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1432000..1432061 + 62 NuclAT_15 - -
- 1432000..1432061 + 62 NuclAT_15 - -
- 1432000..1432061 + 62 NuclAT_15 - -
- 1432000..1432061 + 62 NuclAT_15 - -
- 1432000..1432061 + 62 NuclAT_18 - -
- 1432000..1432061 + 62 NuclAT_18 - -
- 1432000..1432061 + 62 NuclAT_18 - -
- 1432000..1432061 + 62 NuclAT_18 - -
- 1432000..1432061 + 62 NuclAT_21 - -
- 1432000..1432061 + 62 NuclAT_21 - -
- 1432000..1432061 + 62 NuclAT_21 - -
- 1432000..1432061 + 62 NuclAT_21 - -
- 1432000..1432061 + 62 NuclAT_24 - -
- 1432000..1432061 + 62 NuclAT_24 - -
- 1432000..1432061 + 62 NuclAT_24 - -
- 1432000..1432061 + 62 NuclAT_24 - -
- 1432000..1432061 + 62 NuclAT_27 - -
- 1432000..1432061 + 62 NuclAT_27 - -
- 1432000..1432061 + 62 NuclAT_27 - -
- 1432000..1432061 + 62 NuclAT_27 - -
- 1432000..1432061 + 62 NuclAT_30 - -
- 1432000..1432061 + 62 NuclAT_30 - -
- 1432000..1432061 + 62 NuclAT_30 - -
- 1432000..1432061 + 62 NuclAT_30 - -
- 1432000..1432062 + 63 NuclAT_45 - -
- 1432000..1432062 + 63 NuclAT_45 - -
- 1432000..1432062 + 63 NuclAT_45 - -
- 1432000..1432062 + 63 NuclAT_45 - -
- 1432000..1432062 + 63 NuclAT_48 - -
- 1432000..1432062 + 63 NuclAT_48 - -
- 1432000..1432062 + 63 NuclAT_48 - -
- 1432000..1432062 + 63 NuclAT_48 - -
- 1432000..1432062 + 63 NuclAT_51 - -
- 1432000..1432062 + 63 NuclAT_51 - -
- 1432000..1432062 + 63 NuclAT_51 - -
- 1432000..1432062 + 63 NuclAT_51 - -
- 1432000..1432063 + 64 NuclAT_33 - -
- 1432000..1432063 + 64 NuclAT_33 - -
- 1432000..1432063 + 64 NuclAT_33 - -
- 1432000..1432063 + 64 NuclAT_33 - -
- 1432000..1432063 + 64 NuclAT_35 - -
- 1432000..1432063 + 64 NuclAT_35 - -
- 1432000..1432063 + 64 NuclAT_35 - -
- 1432000..1432063 + 64 NuclAT_35 - -
- 1432000..1432063 + 64 NuclAT_37 - -
- 1432000..1432063 + 64 NuclAT_37 - -
- 1432000..1432063 + 64 NuclAT_37 - -
- 1432000..1432063 + 64 NuclAT_37 - -
- 1432000..1432063 + 64 NuclAT_39 - -
- 1432000..1432063 + 64 NuclAT_39 - -
- 1432000..1432063 + 64 NuclAT_39 - -
- 1432000..1432063 + 64 NuclAT_39 - -
- 1432000..1432063 + 64 NuclAT_41 - -
- 1432000..1432063 + 64 NuclAT_41 - -
- 1432000..1432063 + 64 NuclAT_41 - -
- 1432000..1432063 + 64 NuclAT_41 - -
- 1432000..1432063 + 64 NuclAT_43 - -
- 1432000..1432063 + 64 NuclAT_43 - -
- 1432000..1432063 + 64 NuclAT_43 - -
- 1432000..1432063 + 64 NuclAT_43 - -
JE76HU_RS07120 1432376..1432483 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1432530..1432596 + 67 - - Antitoxin
JE76HU_RS07125 1432888..1433988 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
JE76HU_RS07130 1434258..1434488 + 231 WP_001146442.1 putative cation transport regulator ChaB -
JE76HU_RS07135 1434646..1435341 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
JE76HU_RS07140 1435385..1435738 - 354 WP_001169666.1 DsrE/F sulfur relay family protein YchN -
JE76HU_RS07145 1435923..1437317 + 1395 WP_000086212.1 inverse autotransporter invasin YchO -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T44504 WP_000170965.1 NZ_AP028094:c1432483-1432376 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T44504 NZ_AP028094:c1432483-1432376 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT44504 NZ_AP028094:1432530-1432596 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029


Antitoxin

Download structure file

References