Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 1431840..1432061 Replicon chromosome
Accession NZ_AP028094
Organism Escherichia coli strain JNE132847

Toxin (Protein)


Gene name ldrD Uniprot ID E0IV43
Locus tag JE76HU_RS07115 Protein ID WP_000170926.1
Coordinates 1431840..1431947 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 1432000..1432061 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JE76HU_RS07085 (1427149) 1427149..1428231 + 1083 WP_000804726.1 peptide chain release factor 1 -
JE76HU_RS07090 (1428231) 1428231..1429064 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
JE76HU_RS07095 (1429061) 1429061..1429453 + 393 WP_137549514.1 invasion regulator SirB2 -
JE76HU_RS07100 (1429457) 1429457..1430266 + 810 WP_001257044.1 invasion regulator SirB1 -
JE76HU_RS07105 (1430302) 1430302..1431156 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
JE76HU_RS07110 (1431305) 1431305..1431412 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1431462) 1431462..1431525 + 64 NuclAT_16 - -
- (1431462) 1431462..1431525 + 64 NuclAT_16 - -
- (1431462) 1431462..1431525 + 64 NuclAT_16 - -
- (1431462) 1431462..1431525 + 64 NuclAT_16 - -
- (1431462) 1431462..1431525 + 64 NuclAT_19 - -
- (1431462) 1431462..1431525 + 64 NuclAT_19 - -
- (1431462) 1431462..1431525 + 64 NuclAT_19 - -
- (1431462) 1431462..1431525 + 64 NuclAT_19 - -
- (1431462) 1431462..1431525 + 64 NuclAT_22 - -
- (1431462) 1431462..1431525 + 64 NuclAT_22 - -
- (1431462) 1431462..1431525 + 64 NuclAT_22 - -
- (1431462) 1431462..1431525 + 64 NuclAT_22 - -
- (1431462) 1431462..1431525 + 64 NuclAT_25 - -
- (1431462) 1431462..1431525 + 64 NuclAT_25 - -
- (1431462) 1431462..1431525 + 64 NuclAT_25 - -
- (1431462) 1431462..1431525 + 64 NuclAT_25 - -
- (1431462) 1431462..1431525 + 64 NuclAT_28 - -
- (1431462) 1431462..1431525 + 64 NuclAT_28 - -
- (1431462) 1431462..1431525 + 64 NuclAT_28 - -
- (1431462) 1431462..1431525 + 64 NuclAT_28 - -
- (1431462) 1431462..1431525 + 64 NuclAT_31 - -
- (1431462) 1431462..1431525 + 64 NuclAT_31 - -
- (1431462) 1431462..1431525 + 64 NuclAT_31 - -
- (1431462) 1431462..1431525 + 64 NuclAT_31 - -
- (1431460) 1431460..1431526 + 67 NuclAT_44 - -
- (1431460) 1431460..1431526 + 67 NuclAT_44 - -
- (1431460) 1431460..1431526 + 67 NuclAT_44 - -
- (1431460) 1431460..1431526 + 67 NuclAT_44 - -
- (1431460) 1431460..1431526 + 67 NuclAT_47 - -
- (1431460) 1431460..1431526 + 67 NuclAT_47 - -
- (1431460) 1431460..1431526 + 67 NuclAT_47 - -
- (1431460) 1431460..1431526 + 67 NuclAT_47 - -
- (1431460) 1431460..1431526 + 67 NuclAT_50 - -
- (1431460) 1431460..1431526 + 67 NuclAT_50 - -
- (1431460) 1431460..1431526 + 67 NuclAT_50 - -
- (1431460) 1431460..1431526 + 67 NuclAT_50 - -
JE76HU_RS07115 (1431840) 1431840..1431947 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1432000) 1432000..1432061 + 62 NuclAT_15 - Antitoxin
- (1432000) 1432000..1432061 + 62 NuclAT_15 - Antitoxin
- (1432000) 1432000..1432061 + 62 NuclAT_15 - Antitoxin
- (1432000) 1432000..1432061 + 62 NuclAT_15 - Antitoxin
- (1432000) 1432000..1432061 + 62 NuclAT_18 - Antitoxin
- (1432000) 1432000..1432061 + 62 NuclAT_18 - Antitoxin
- (1432000) 1432000..1432061 + 62 NuclAT_18 - Antitoxin
- (1432000) 1432000..1432061 + 62 NuclAT_18 - Antitoxin
- (1432000) 1432000..1432061 + 62 NuclAT_21 - Antitoxin
- (1432000) 1432000..1432061 + 62 NuclAT_21 - Antitoxin
- (1432000) 1432000..1432061 + 62 NuclAT_21 - Antitoxin
- (1432000) 1432000..1432061 + 62 NuclAT_21 - Antitoxin
- (1432000) 1432000..1432061 + 62 NuclAT_24 - Antitoxin
- (1432000) 1432000..1432061 + 62 NuclAT_24 - Antitoxin
- (1432000) 1432000..1432061 + 62 NuclAT_24 - Antitoxin
- (1432000) 1432000..1432061 + 62 NuclAT_24 - Antitoxin
- (1432000) 1432000..1432061 + 62 NuclAT_27 - Antitoxin
- (1432000) 1432000..1432061 + 62 NuclAT_27 - Antitoxin
- (1432000) 1432000..1432061 + 62 NuclAT_27 - Antitoxin
- (1432000) 1432000..1432061 + 62 NuclAT_27 - Antitoxin
- (1432000) 1432000..1432061 + 62 NuclAT_30 - Antitoxin
- (1432000) 1432000..1432061 + 62 NuclAT_30 - Antitoxin
- (1432000) 1432000..1432061 + 62 NuclAT_30 - Antitoxin
- (1432000) 1432000..1432061 + 62 NuclAT_30 - Antitoxin
- (1432000) 1432000..1432062 + 63 NuclAT_45 - -
- (1432000) 1432000..1432062 + 63 NuclAT_45 - -
- (1432000) 1432000..1432062 + 63 NuclAT_45 - -
- (1432000) 1432000..1432062 + 63 NuclAT_45 - -
- (1432000) 1432000..1432062 + 63 NuclAT_48 - -
- (1432000) 1432000..1432062 + 63 NuclAT_48 - -
- (1432000) 1432000..1432062 + 63 NuclAT_48 - -
- (1432000) 1432000..1432062 + 63 NuclAT_48 - -
- (1432000) 1432000..1432062 + 63 NuclAT_51 - -
- (1432000) 1432000..1432062 + 63 NuclAT_51 - -
- (1432000) 1432000..1432062 + 63 NuclAT_51 - -
- (1432000) 1432000..1432062 + 63 NuclAT_51 - -
- (1432000) 1432000..1432063 + 64 NuclAT_33 - -
- (1432000) 1432000..1432063 + 64 NuclAT_33 - -
- (1432000) 1432000..1432063 + 64 NuclAT_33 - -
- (1432000) 1432000..1432063 + 64 NuclAT_33 - -
- (1432000) 1432000..1432063 + 64 NuclAT_35 - -
- (1432000) 1432000..1432063 + 64 NuclAT_35 - -
- (1432000) 1432000..1432063 + 64 NuclAT_35 - -
- (1432000) 1432000..1432063 + 64 NuclAT_35 - -
- (1432000) 1432000..1432063 + 64 NuclAT_37 - -
- (1432000) 1432000..1432063 + 64 NuclAT_37 - -
- (1432000) 1432000..1432063 + 64 NuclAT_37 - -
- (1432000) 1432000..1432063 + 64 NuclAT_37 - -
- (1432000) 1432000..1432063 + 64 NuclAT_39 - -
- (1432000) 1432000..1432063 + 64 NuclAT_39 - -
- (1432000) 1432000..1432063 + 64 NuclAT_39 - -
- (1432000) 1432000..1432063 + 64 NuclAT_39 - -
- (1432000) 1432000..1432063 + 64 NuclAT_41 - -
- (1432000) 1432000..1432063 + 64 NuclAT_41 - -
- (1432000) 1432000..1432063 + 64 NuclAT_41 - -
- (1432000) 1432000..1432063 + 64 NuclAT_41 - -
- (1432000) 1432000..1432063 + 64 NuclAT_43 - -
- (1432000) 1432000..1432063 + 64 NuclAT_43 - -
- (1432000) 1432000..1432063 + 64 NuclAT_43 - -
- (1432000) 1432000..1432063 + 64 NuclAT_43 - -
JE76HU_RS07120 (1432376) 1432376..1432483 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1432531) 1432531..1432596 + 66 NuclAT_14 - -
- (1432531) 1432531..1432596 + 66 NuclAT_14 - -
- (1432531) 1432531..1432596 + 66 NuclAT_14 - -
- (1432531) 1432531..1432596 + 66 NuclAT_14 - -
- (1432531) 1432531..1432596 + 66 NuclAT_17 - -
- (1432531) 1432531..1432596 + 66 NuclAT_17 - -
- (1432531) 1432531..1432596 + 66 NuclAT_17 - -
- (1432531) 1432531..1432596 + 66 NuclAT_17 - -
- (1432531) 1432531..1432596 + 66 NuclAT_20 - -
- (1432531) 1432531..1432596 + 66 NuclAT_20 - -
- (1432531) 1432531..1432596 + 66 NuclAT_20 - -
- (1432531) 1432531..1432596 + 66 NuclAT_20 - -
- (1432531) 1432531..1432596 + 66 NuclAT_23 - -
- (1432531) 1432531..1432596 + 66 NuclAT_23 - -
- (1432531) 1432531..1432596 + 66 NuclAT_23 - -
- (1432531) 1432531..1432596 + 66 NuclAT_23 - -
- (1432531) 1432531..1432596 + 66 NuclAT_26 - -
- (1432531) 1432531..1432596 + 66 NuclAT_26 - -
- (1432531) 1432531..1432596 + 66 NuclAT_26 - -
- (1432531) 1432531..1432596 + 66 NuclAT_26 - -
- (1432531) 1432531..1432596 + 66 NuclAT_29 - -
- (1432531) 1432531..1432596 + 66 NuclAT_29 - -
- (1432531) 1432531..1432596 + 66 NuclAT_29 - -
- (1432531) 1432531..1432596 + 66 NuclAT_29 - -
- (1432532) 1432532..1432597 + 66 NuclAT_46 - -
- (1432532) 1432532..1432597 + 66 NuclAT_46 - -
- (1432532) 1432532..1432597 + 66 NuclAT_46 - -
- (1432532) 1432532..1432597 + 66 NuclAT_46 - -
- (1432532) 1432532..1432597 + 66 NuclAT_49 - -
- (1432532) 1432532..1432597 + 66 NuclAT_49 - -
- (1432532) 1432532..1432597 + 66 NuclAT_49 - -
- (1432532) 1432532..1432597 + 66 NuclAT_49 - -
- (1432532) 1432532..1432597 + 66 NuclAT_52 - -
- (1432532) 1432532..1432597 + 66 NuclAT_52 - -
- (1432532) 1432532..1432597 + 66 NuclAT_52 - -
- (1432532) 1432532..1432597 + 66 NuclAT_52 - -
- (1432531) 1432531..1432598 + 68 NuclAT_32 - -
- (1432531) 1432531..1432598 + 68 NuclAT_32 - -
- (1432531) 1432531..1432598 + 68 NuclAT_32 - -
- (1432531) 1432531..1432598 + 68 NuclAT_32 - -
- (1432531) 1432531..1432598 + 68 NuclAT_34 - -
- (1432531) 1432531..1432598 + 68 NuclAT_34 - -
- (1432531) 1432531..1432598 + 68 NuclAT_34 - -
- (1432531) 1432531..1432598 + 68 NuclAT_34 - -
- (1432531) 1432531..1432598 + 68 NuclAT_36 - -
- (1432531) 1432531..1432598 + 68 NuclAT_36 - -
- (1432531) 1432531..1432598 + 68 NuclAT_36 - -
- (1432531) 1432531..1432598 + 68 NuclAT_36 - -
- (1432531) 1432531..1432598 + 68 NuclAT_38 - -
- (1432531) 1432531..1432598 + 68 NuclAT_38 - -
- (1432531) 1432531..1432598 + 68 NuclAT_38 - -
- (1432531) 1432531..1432598 + 68 NuclAT_38 - -
- (1432531) 1432531..1432598 + 68 NuclAT_40 - -
- (1432531) 1432531..1432598 + 68 NuclAT_40 - -
- (1432531) 1432531..1432598 + 68 NuclAT_40 - -
- (1432531) 1432531..1432598 + 68 NuclAT_40 - -
- (1432531) 1432531..1432598 + 68 NuclAT_42 - -
- (1432531) 1432531..1432598 + 68 NuclAT_42 - -
- (1432531) 1432531..1432598 + 68 NuclAT_42 - -
- (1432531) 1432531..1432598 + 68 NuclAT_42 - -
JE76HU_RS07125 (1432888) 1432888..1433988 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
JE76HU_RS07130 (1434258) 1434258..1434488 + 231 WP_001146442.1 putative cation transport regulator ChaB -
JE76HU_RS07135 (1434646) 1434646..1435341 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
JE76HU_RS07140 (1435385) 1435385..1435738 - 354 WP_001169666.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.84 Da        Isoelectric Point: 11.6501

>T44500 WP_000170926.1 NZ_AP028094:c1431947-1431840 [Escherichia coli]
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T44500 NZ_AP028094:c1431947-1431840 [Escherichia coli]
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT44500 NZ_AP028094:1432000-1432061 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y1K9

Antitoxin

Download structure file

References