Detailed information of TA system TA044385

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 73382..73636
• Replicon: plasmid pVE-V11-M_1
• Accession: NZ_AP027979
• Organism: Escherichia coli strain VE-V11-M

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: G9G1E3
• Locus tag: QQK36_RS22870
• Protein ID: WP_001312851.1
• Coordinates: 73382..73531 (-)
• Length: 50 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	73575..73636 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QQK36_RS22825 (68939)	68939..69339	-	401	Protein_66	type II toxin-antitoxin system toxin endoribonuclease PemK	-
QQK36_RS22830 (69272)	69272..69529	-	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
QQK36_RS22835 (69621)	69621..69917	-	297	WP_072666786.1	CPBP family intramembrane metalloprotease	-
QQK36_RS22840 (69914)	69914..70273	-	360	WP_134906486.1	histidine phosphatase family protein	-
QQK36_RS22845 (71210)	71210..72067	-	858	WP_286611902.1	incFII family plasmid replication initiator RepA	-
QQK36_RS22850 (72060)	72060..72542	-	483	WP_001273588.1	hypothetical protein	-
QQK36_RS22855 (72535)	72535..72582	-	48	WP_229471593.1	hypothetical protein	-
QQK36_RS22860 (72573)	72573..72824	+	252	WP_223195197.1	replication protein RepA	-
QQK36_RS22865 (72841)	72841..73098	-	258	WP_000083845.1	replication regulatory protein RepA	-
QQK36_RS22870 (73382)	73382..73531	-	150	WP_001312851.1	Hok/Gef family protein	Toxin
- (73575)	73575..73636	+	62	NuclAT_1	-	Antitoxin
- (73575)	73575..73636	+	62	NuclAT_1	-	Antitoxin
- (73575)	73575..73636	+	62	NuclAT_1	-	Antitoxin
- (73575)	73575..73636	+	62	NuclAT_1	-	Antitoxin
QQK36_RS22875 (73892)	73892..73966	-	75	Protein_76	endonuclease	-
QQK36_RS22880 (74212)	74212..74424	-	213	WP_001299730.1	ANR family transcriptional regulator	-
QQK36_RS22885 (74560)	74560..75120	-	561	WP_000139315.1	fertility inhibition protein FinO	-
QQK36_RS22890 (75223)	75223..76083	-	861	WP_237442101.1	alpha/beta hydrolase	-
QQK36_RS22895 (76142)	76142..76888	-	747	WP_284330307.1	conjugal transfer pilus acetylase TraX	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B / aac(3)-IId / dfrA14 / sitABCD	iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA	1..138038	138038
	-	flank	IS/Tn	dfrA14	-	65587..68822	3235

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-45)

Sequences

Toxin

Protein

• Length: 50 a.a.
• Molecular weight: 5542.67 Da
• Isoelectric Point: 8.7678

>T44385 WP_001312851.1 NZ_AP027979:c73531-73382 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 150 bp

>T44385 NZ_AP027979:c73531-73382 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGAGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin

Nucleotide

• Length: 62 bp

>AT44385 NZ_AP027979:73575-73636 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A829C8K5

Antitoxin