Detailed information of TA system TA044362

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 34411..34680
• Replicon: plasmid pVE-V10-F_2
• Accession: NZ_AP027973
• Organism: Escherichia coli strain VE-V10-F

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QQK73_RS25000
• Protein ID: WP_001372321.1
• Coordinates: 34555..34680 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	34411..34476 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QQK73_RS24960 (29453)	29453..29713	+	261	WP_071600428.1	hypothetical protein	-
QQK73_RS24965 (30183)	30183..30710	+	528	WP_000290793.1	single-stranded DNA-binding protein	-
QQK73_RS24970 (30766)	30766..30999	+	234	WP_000006004.1	DUF905 domain-containing protein	-
QQK73_RS24975 (31058)	31058..33023	+	1966	Protein_40	ParB/RepB/Spo0J family partition protein	-
QQK73_RS24980 (33092)	33092..33526	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
QQK73_RS24985 (33523)	33523..34285	+	763	Protein_42	plasmid SOS inhibition protein A	-
QQK73_RS24990 (34263)	34263..34442	-	180	WP_001309233.1	hypothetical protein	-
- (34410)	34410..34473	-	64	NuclAT_1	-	-
- (34410)	34410..34473	-	64	NuclAT_1	-	-
- (34411)	34411..34476	+	66	NuclAT_0	-	Antitoxin
- (34411)	34411..34476	+	66	NuclAT_0	-	Antitoxin
- (34411)	34411..34476	+	66	NuclAT_1	-	Antitoxin
- (34254)	34254..34478	+	225	NuclAT_0	-	-
- (34254)	34254..34478	+	225	NuclAT_0	-	-
- (34254)	34254..34478	+	225	NuclAT_0	-	-
- (34254)	34254..34478	+	225	NuclAT_0	-	-
- (34254)	34254..34478	-	225	NuclAT_0	-	-
QQK73_RS24995 (34464)	34464..34613	+	150	Protein_44	plasmid maintenance protein Mok	-
QQK73_RS25000 (34555)	34555..34680	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QQK73_RS25005 (34999)	34999..35295	-	297	Protein_46	hypothetical protein	-
QQK73_RS25010 (35595)	35595..35891	+	297	WP_001272251.1	hypothetical protein	-
QQK73_RS25015 (36002)	36002..36823	+	822	WP_001234445.1	DUF932 domain-containing protein	-
QQK73_RS25020 (37120)	37120..37722	-	603	WP_000243713.1	transglycosylase SLT domain-containing protein	-
QQK73_RS25025 (38045)	38045..38428	+	384	WP_001354030.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QQK73_RS25030 (38622)	38622..39293	+	672	WP_000283561.1	conjugal transfer transcriptional regulator TraJ	-
QQK73_RS25035 (39430)	39430..39657	+	228	WP_000089263.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T44362 WP_001372321.1 NZ_AP027973:34555-34680 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T44362 NZ_AP027973:34555-34680 [Escherichia coli]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT44362 NZ_AP027973:34411-34476 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC

Structures

Antitoxin