Detailed information of TA system TA044326

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 46106..46375
• Replicon: plasmid pVE-T9_2
• Accession: NZ_AP027965
• Organism: Escherichia coli strain VE-T9

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QQK52_RS23115
• Protein ID: WP_001372321.1
• Coordinates: 46250..46375 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	46106..46171 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QQK52_RS23070 (41122)	41122..41400	+	279	WP_071811814.1	hypothetical protein	-
QQK52_RS23075 (41641)	41641..41847	+	207	WP_000275858.1	hypothetical protein	-
QQK52_RS23080 (41873)	41873..42412	+	540	WP_001825195.1	single-stranded DNA-binding protein	-
QQK52_RS23085 (42475)	42475..42708	+	234	WP_000005990.1	DUF905 family protein	-
QQK52_RS23090 (42774)	42774..44732	+	1959	WP_065800285.1	ParB/RepB/Spo0J family partition protein	-
QQK52_RS23095 (44787)	44787..45221	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
QQK52_RS23100 (45218)	45218..45980	+	763	Protein_51	plasmid SOS inhibition protein A	-
QQK52_RS23105 (45949)	45949..46137	-	189	WP_001299721.1	hypothetical protein	-
- (46105)	46105..46168	-	64	NuclAT_1	-	-
- (46105)	46105..46168	-	64	NuclAT_1	-	-
- (46106)	46106..46171	+	66	NuclAT_0	-	Antitoxin
- (46106)	46106..46171	+	66	NuclAT_0	-	Antitoxin
- (46106)	46106..46171	+	66	NuclAT_1	-	Antitoxin
- (45949)	45949..46173	+	225	NuclAT_0	-	-
- (45949)	45949..46173	+	225	NuclAT_0	-	-
- (45949)	45949..46173	+	225	NuclAT_0	-	-
- (45949)	45949..46173	+	225	NuclAT_0	-	-
- (45949)	45949..46173	-	225	NuclAT_0	-	-
QQK52_RS23110 (46159)	46159..46308	+	150	Protein_53	plasmid maintenance protein Mok	-
QQK52_RS23115 (46250)	46250..46375	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QQK52_RS23120 (46595)	46595..46825	+	231	WP_001426396.1	hypothetical protein	-
QQK52_RS23125 (46823)	46823..46996	-	174	Protein_56	hypothetical protein	-
QQK52_RS23130 (47066)	47066..47272	+	207	WP_000547968.1	hypothetical protein	-
QQK52_RS23135 (47297)	47297..47584	+	288	WP_000107544.1	hypothetical protein	-
QQK52_RS23140 (47702)	47702..48523	+	822	WP_001234469.1	DUF932 domain-containing protein	-
QQK52_RS23145 (48820)	48820..49467	-	648	WP_031943493.1	transglycosylase SLT domain-containing protein	-
QQK52_RS23150 (49744)	49744..50127	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QQK52_RS23155 (50318)	50318..51004	+	687	WP_000332484.1	PAS domain-containing protein	-
QQK52_RS23160 (51098)	51098..51325	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T44326 WP_001372321.1 NZ_AP027965:46250-46375 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T44326 NZ_AP027965:46250-46375 [Escherichia coli]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT44326 NZ_AP027965:46106-46171 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC

Structures

Antitoxin