Detailed information of TA system TA044265

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 13950..14204
• Replicon: plasmid pVE-T10_1
• Accession: NZ_AP027958
• Organism: Escherichia coli strain VE-T10

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: G9G1E3
• Locus tag: QQK14_RS23880
• Protein ID: WP_001312851.1
• Coordinates: 14055..14204 (+)
• Length: 50 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	13950..14011 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QQK14_RS23840 (8985)	8985..9176	+	192	WP_001027495.1	hypothetical protein	-
QQK14_RS23845 (9146)	9146..9655	-	510	WP_071600123.1	hypothetical protein	-
QQK14_RS23850 (9973)	9973..10512	+	540	WP_000290801.1	single-stranded DNA-binding protein	-
QQK14_RS23855 (10569)	10569..10802	+	234	WP_000005990.1	DUF905 family protein	-
QQK14_RS23860 (10868)	10868..12034	+	1167	Protein_15	type IV secretion system DNA-binding domain-containing protein	-
QQK14_RS23865 (12032)	12032..12646	+	615	Protein_16	conjugal transfer pilus acetylase TraX	-
QQK14_RS23870 (12701)	12701..13261	+	561	WP_000139310.1	fertility inhibition protein FinO	-
QQK14_RS23875 (13396)	13396..13608	+	213	WP_001541896.1	ANR family transcriptional regulator	-
- (13950)	13950..14011	-	62	NuclAT_0	-	Antitoxin
- (13950)	13950..14011	-	62	NuclAT_0	-	Antitoxin
- (13950)	13950..14011	-	62	NuclAT_0	-	Antitoxin
- (13950)	13950..14011	-	62	NuclAT_0	-	Antitoxin
QQK14_RS23880 (14055)	14055..14204	+	150	WP_001312851.1	Hok/Gef family protein	Toxin
QQK14_RS23885 (14472)	14472..14729	+	258	WP_001541895.1	replication regulatory protein RepA	-
QQK14_RS23890 (14961)	14961..15035	+	75	WP_061357229.1	RepA leader peptide Tap	-
QQK14_RS23895 (15028)	15028..15885	+	858	WP_039002220.1	incFII family plasmid replication initiator RepA	-
QQK14_RS23900 (16851)	16851..17102	+	252	WP_001132900.1	type II toxin-antitoxin system Phd/YefM family antitoxin	-
QQK14_RS23905 (17099)	17099..17386	+	288	WP_000222766.1	type II toxin-antitoxin system RelE/ParE family toxin	-
QQK14_RS23910 (17461)	17461..17649	-	189	Protein_25	IS3 family transposase	-
QQK14_RS23915 (17683)	17683..19196	-	1514	Protein_26	Tn3-like element TnAs1 family transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	sul2 / floR / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / tet(M) / sitABCD	iucA / iucB / iucC / iucD / iutA	1..81505	81505

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-45)

Sequences

Toxin

Protein

• Length: 50 a.a.
• Molecular weight: 5542.67 Da
• Isoelectric Point: 8.7678

>T44265 WP_001312851.1 NZ_AP027958:14055-14204 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 150 bp

>T44265 NZ_AP027958:14055-14204 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACTGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGAGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin

Nucleotide

• Length: 62 bp

>AT44265 NZ_AP027958:c14011-13950 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A829C8K5

Antitoxin