Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-sokC/Ldr(toxin)
Location 2785626..2785848 Replicon chromosome
Accession NZ_AP027957
Organism Escherichia coli strain VE-T10

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag QQK14_RS13680 Protein ID WP_000170965.1
Coordinates 2785741..2785848 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name sokC
Locus tag -
Coordinates 2785626..2785693 (-)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQK14_RS13655 (2780907) 2780907..2782301 - 1395 WP_000086213.1 inverse autotransporter invasin YchO -
QQK14_RS13660 (2782486) 2782486..2782839 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
QQK14_RS13665 (2782883) 2782883..2783578 - 696 WP_172615460.1 glutathione-specific gamma-glutamylcyclotransferase -
QQK14_RS13670 (2783736) 2783736..2783966 - 231 WP_001146442.1 putative cation transport regulator ChaB -
QQK14_RS13675 (2784236) 2784236..2785336 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- (2785626) 2785626..2785693 - 68 NuclAT_15 - Antitoxin
- (2785626) 2785626..2785693 - 68 NuclAT_15 - Antitoxin
- (2785626) 2785626..2785693 - 68 NuclAT_15 - Antitoxin
- (2785626) 2785626..2785693 - 68 NuclAT_15 - Antitoxin
- (2785626) 2785626..2785693 - 68 NuclAT_16 - Antitoxin
- (2785626) 2785626..2785693 - 68 NuclAT_16 - Antitoxin
- (2785626) 2785626..2785693 - 68 NuclAT_16 - Antitoxin
- (2785626) 2785626..2785693 - 68 NuclAT_16 - Antitoxin
- (2785626) 2785626..2785693 - 68 NuclAT_17 - Antitoxin
- (2785626) 2785626..2785693 - 68 NuclAT_17 - Antitoxin
- (2785626) 2785626..2785693 - 68 NuclAT_17 - Antitoxin
- (2785626) 2785626..2785693 - 68 NuclAT_17 - Antitoxin
- (2785626) 2785626..2785693 - 68 NuclAT_18 - Antitoxin
- (2785626) 2785626..2785693 - 68 NuclAT_18 - Antitoxin
- (2785626) 2785626..2785693 - 68 NuclAT_18 - Antitoxin
- (2785626) 2785626..2785693 - 68 NuclAT_18 - Antitoxin
- (2785626) 2785626..2785693 - 68 NuclAT_19 - Antitoxin
- (2785626) 2785626..2785693 - 68 NuclAT_19 - Antitoxin
- (2785626) 2785626..2785693 - 68 NuclAT_19 - Antitoxin
- (2785626) 2785626..2785693 - 68 NuclAT_19 - Antitoxin
- (2785626) 2785626..2785693 - 68 NuclAT_20 - Antitoxin
- (2785626) 2785626..2785693 - 68 NuclAT_20 - Antitoxin
- (2785626) 2785626..2785693 - 68 NuclAT_20 - Antitoxin
- (2785626) 2785626..2785693 - 68 NuclAT_20 - Antitoxin
QQK14_RS13680 (2785741) 2785741..2785848 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2786163) 2786163..2786226 - 64 NuclAT_27 - -
- (2786163) 2786163..2786226 - 64 NuclAT_27 - -
- (2786163) 2786163..2786226 - 64 NuclAT_27 - -
- (2786163) 2786163..2786226 - 64 NuclAT_27 - -
- (2786163) 2786163..2786226 - 64 NuclAT_28 - -
- (2786163) 2786163..2786226 - 64 NuclAT_28 - -
- (2786163) 2786163..2786226 - 64 NuclAT_28 - -
- (2786163) 2786163..2786226 - 64 NuclAT_28 - -
- (2786162) 2786162..2786228 - 67 NuclAT_21 - -
- (2786162) 2786162..2786228 - 67 NuclAT_21 - -
- (2786162) 2786162..2786228 - 67 NuclAT_21 - -
- (2786162) 2786162..2786228 - 67 NuclAT_21 - -
- (2786162) 2786162..2786228 - 67 NuclAT_22 - -
- (2786162) 2786162..2786228 - 67 NuclAT_22 - -
- (2786162) 2786162..2786228 - 67 NuclAT_22 - -
- (2786162) 2786162..2786228 - 67 NuclAT_22 - -
- (2786162) 2786162..2786228 - 67 NuclAT_23 - -
- (2786162) 2786162..2786228 - 67 NuclAT_23 - -
- (2786162) 2786162..2786228 - 67 NuclAT_23 - -
- (2786162) 2786162..2786228 - 67 NuclAT_23 - -
- (2786162) 2786162..2786228 - 67 NuclAT_24 - -
- (2786162) 2786162..2786228 - 67 NuclAT_24 - -
- (2786162) 2786162..2786228 - 67 NuclAT_24 - -
- (2786162) 2786162..2786228 - 67 NuclAT_24 - -
- (2786162) 2786162..2786228 - 67 NuclAT_25 - -
- (2786162) 2786162..2786228 - 67 NuclAT_25 - -
- (2786162) 2786162..2786228 - 67 NuclAT_25 - -
- (2786162) 2786162..2786228 - 67 NuclAT_25 - -
- (2786162) 2786162..2786228 - 67 NuclAT_26 - -
- (2786162) 2786162..2786228 - 67 NuclAT_26 - -
- (2786162) 2786162..2786228 - 67 NuclAT_26 - -
- (2786162) 2786162..2786228 - 67 NuclAT_26 - -
QQK14_RS13685 (2786276) 2786276..2786383 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
QQK14_RS13690 (2786532) 2786532..2787386 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QQK14_RS13695 (2787422) 2787422..2788231 - 810 WP_001257044.1 invasion regulator SirB1 -
QQK14_RS13700 (2788235) 2788235..2788627 - 393 WP_000200378.1 invasion regulator SirB2 -
QQK14_RS13705 (2788624) 2788624..2789457 - 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
QQK14_RS13710 (2789457) 2789457..2790539 - 1083 WP_000804726.1 peptide chain release factor 1 -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T44256 WP_000170965.1 NZ_AP027957:2785741-2785848 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T44256 NZ_AP027957:2785741-2785848 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT44256 NZ_AP027957:c2785693-2785626 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029


Antitoxin

Download structure file

References