Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-sokC/Ldr(toxin) |
Location | 2785626..2785848 | Replicon | chromosome |
Accession | NZ_AP027957 | ||
Organism | Escherichia coli strain VE-T10 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | B7LGX8 |
Locus tag | QQK14_RS13680 | Protein ID | WP_000170965.1 |
Coordinates | 2785741..2785848 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 2785626..2785693 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQK14_RS13655 (2780907) | 2780907..2782301 | - | 1395 | WP_000086213.1 | inverse autotransporter invasin YchO | - |
QQK14_RS13660 (2782486) | 2782486..2782839 | + | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
QQK14_RS13665 (2782883) | 2782883..2783578 | - | 696 | WP_172615460.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
QQK14_RS13670 (2783736) | 2783736..2783966 | - | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
QQK14_RS13675 (2784236) | 2784236..2785336 | + | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
- (2785626) | 2785626..2785693 | - | 68 | NuclAT_15 | - | Antitoxin |
- (2785626) | 2785626..2785693 | - | 68 | NuclAT_15 | - | Antitoxin |
- (2785626) | 2785626..2785693 | - | 68 | NuclAT_15 | - | Antitoxin |
- (2785626) | 2785626..2785693 | - | 68 | NuclAT_15 | - | Antitoxin |
- (2785626) | 2785626..2785693 | - | 68 | NuclAT_16 | - | Antitoxin |
- (2785626) | 2785626..2785693 | - | 68 | NuclAT_16 | - | Antitoxin |
- (2785626) | 2785626..2785693 | - | 68 | NuclAT_16 | - | Antitoxin |
- (2785626) | 2785626..2785693 | - | 68 | NuclAT_16 | - | Antitoxin |
- (2785626) | 2785626..2785693 | - | 68 | NuclAT_17 | - | Antitoxin |
- (2785626) | 2785626..2785693 | - | 68 | NuclAT_17 | - | Antitoxin |
- (2785626) | 2785626..2785693 | - | 68 | NuclAT_17 | - | Antitoxin |
- (2785626) | 2785626..2785693 | - | 68 | NuclAT_17 | - | Antitoxin |
- (2785626) | 2785626..2785693 | - | 68 | NuclAT_18 | - | Antitoxin |
- (2785626) | 2785626..2785693 | - | 68 | NuclAT_18 | - | Antitoxin |
- (2785626) | 2785626..2785693 | - | 68 | NuclAT_18 | - | Antitoxin |
- (2785626) | 2785626..2785693 | - | 68 | NuclAT_18 | - | Antitoxin |
- (2785626) | 2785626..2785693 | - | 68 | NuclAT_19 | - | Antitoxin |
- (2785626) | 2785626..2785693 | - | 68 | NuclAT_19 | - | Antitoxin |
- (2785626) | 2785626..2785693 | - | 68 | NuclAT_19 | - | Antitoxin |
- (2785626) | 2785626..2785693 | - | 68 | NuclAT_19 | - | Antitoxin |
- (2785626) | 2785626..2785693 | - | 68 | NuclAT_20 | - | Antitoxin |
- (2785626) | 2785626..2785693 | - | 68 | NuclAT_20 | - | Antitoxin |
- (2785626) | 2785626..2785693 | - | 68 | NuclAT_20 | - | Antitoxin |
- (2785626) | 2785626..2785693 | - | 68 | NuclAT_20 | - | Antitoxin |
QQK14_RS13680 (2785741) | 2785741..2785848 | + | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- (2786163) | 2786163..2786226 | - | 64 | NuclAT_27 | - | - |
- (2786163) | 2786163..2786226 | - | 64 | NuclAT_27 | - | - |
- (2786163) | 2786163..2786226 | - | 64 | NuclAT_27 | - | - |
- (2786163) | 2786163..2786226 | - | 64 | NuclAT_27 | - | - |
- (2786163) | 2786163..2786226 | - | 64 | NuclAT_28 | - | - |
- (2786163) | 2786163..2786226 | - | 64 | NuclAT_28 | - | - |
- (2786163) | 2786163..2786226 | - | 64 | NuclAT_28 | - | - |
- (2786163) | 2786163..2786226 | - | 64 | NuclAT_28 | - | - |
- (2786162) | 2786162..2786228 | - | 67 | NuclAT_21 | - | - |
- (2786162) | 2786162..2786228 | - | 67 | NuclAT_21 | - | - |
- (2786162) | 2786162..2786228 | - | 67 | NuclAT_21 | - | - |
- (2786162) | 2786162..2786228 | - | 67 | NuclAT_21 | - | - |
- (2786162) | 2786162..2786228 | - | 67 | NuclAT_22 | - | - |
- (2786162) | 2786162..2786228 | - | 67 | NuclAT_22 | - | - |
- (2786162) | 2786162..2786228 | - | 67 | NuclAT_22 | - | - |
- (2786162) | 2786162..2786228 | - | 67 | NuclAT_22 | - | - |
- (2786162) | 2786162..2786228 | - | 67 | NuclAT_23 | - | - |
- (2786162) | 2786162..2786228 | - | 67 | NuclAT_23 | - | - |
- (2786162) | 2786162..2786228 | - | 67 | NuclAT_23 | - | - |
- (2786162) | 2786162..2786228 | - | 67 | NuclAT_23 | - | - |
- (2786162) | 2786162..2786228 | - | 67 | NuclAT_24 | - | - |
- (2786162) | 2786162..2786228 | - | 67 | NuclAT_24 | - | - |
- (2786162) | 2786162..2786228 | - | 67 | NuclAT_24 | - | - |
- (2786162) | 2786162..2786228 | - | 67 | NuclAT_24 | - | - |
- (2786162) | 2786162..2786228 | - | 67 | NuclAT_25 | - | - |
- (2786162) | 2786162..2786228 | - | 67 | NuclAT_25 | - | - |
- (2786162) | 2786162..2786228 | - | 67 | NuclAT_25 | - | - |
- (2786162) | 2786162..2786228 | - | 67 | NuclAT_25 | - | - |
- (2786162) | 2786162..2786228 | - | 67 | NuclAT_26 | - | - |
- (2786162) | 2786162..2786228 | - | 67 | NuclAT_26 | - | - |
- (2786162) | 2786162..2786228 | - | 67 | NuclAT_26 | - | - |
- (2786162) | 2786162..2786228 | - | 67 | NuclAT_26 | - | - |
QQK14_RS13685 (2786276) | 2786276..2786383 | + | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
QQK14_RS13690 (2786532) | 2786532..2787386 | - | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
QQK14_RS13695 (2787422) | 2787422..2788231 | - | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
QQK14_RS13700 (2788235) | 2788235..2788627 | - | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
QQK14_RS13705 (2788624) | 2788624..2789457 | - | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
QQK14_RS13710 (2789457) | 2789457..2790539 | - | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T44256 WP_000170965.1 NZ_AP027957:2785741-2785848 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T44256 NZ_AP027957:2785741-2785848 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 68 bp
>AT44256 NZ_AP027957:c2785693-2785626 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|