Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 66648..66912 Replicon plasmid p30038n2
Accession NZ_AP027928
Organism Escherichia fergusonii strain 30038

Toxin (Protein)


Gene name pndA Uniprot ID E6BRV3
Locus tag QUE84_RS24240 Protein ID WP_001303307.1
Coordinates 66760..66912 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 66648..66710 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QUE84_RS24225 (61887) 61887..64178 - 2292 WP_001289275.1 F-type conjugative transfer protein TrbC -
QUE84_RS24230 (64171) 64171..65241 - 1071 WP_000151576.1 IncI1-type conjugal transfer protein TrbB -
QUE84_RS24235 (65260) 65260..66468 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (66648) 66648..66710 - 63 NuclAT_0 - Antitoxin
- (66648) 66648..66710 - 63 NuclAT_0 - Antitoxin
- (66648) 66648..66710 - 63 NuclAT_0 - Antitoxin
- (66648) 66648..66710 - 63 NuclAT_0 - Antitoxin
QUE84_RS24240 (66760) 66760..66912 + 153 WP_001303307.1 Hok/Gef family protein Toxin
QUE84_RS24245 (66984) 66984..67235 - 252 WP_001291965.1 hypothetical protein -
QUE84_RS24250 (67735) 67735..67830 + 96 WP_001303310.1 DinQ-like type I toxin DqlB -
QUE84_RS24255 (67895) 67895..68032 - 138 WP_047088497.1 hypothetical protein -
QUE84_RS24260 (68077) 68077..69303 - 1227 WP_024186316.1 RNA-guided endonuclease TnpB family protein -
QUE84_RS24265 (69362) 69362..69766 + 405 WP_001175009.1 IS200/IS605 family transposase -
QUE84_RS24270 (70098) 70098..70307 - 210 WP_032178830.1 hemolysin expression modulator Hha -
QUE84_RS24275 (70405) 70405..71067 - 663 WP_000644794.1 plasmid IncI1-type surface exclusion protein ExcA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - iutA / iucD / iucC / iucB / iucA / fdeC 1..109686 109686


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.21 Da        Isoelectric Point: 8.7948

>T44179 WP_001303307.1 NZ_AP027928:66760-66912 [Escherichia fergusonii]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

>T44179 NZ_AP027928:66760-66912 [Escherichia fergusonii]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA

Antitoxin


Download         Length: 63 bp

>AT44179 NZ_AP027928:c66710-66648 [Escherichia fergusonii]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A634Q5L1

Antitoxin

Download structure file

References