Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 89415..89669 Replicon plasmid pEC291_1
Accession NZ_AP027444
Organism Escherichia coli strain EC291 isolate EC291

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag QUE55_RS01525 Protein ID WP_001312851.1
Coordinates 89520..89669 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 89415..89476 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QUE55_RS01510 (87365) 87365..88111 + 747 WP_001541899.1 conjugal transfer pilus acetylase TraX -
QUE55_RS01515 (88166) 88166..88726 + 561 WP_001541898.1 fertility inhibition protein FinO -
QUE55_RS01520 (88861) 88861..89073 + 213 WP_001541896.1 ANR family transcriptional regulator -
- (89415) 89415..89476 - 62 NuclAT_0 - Antitoxin
- (89415) 89415..89476 - 62 NuclAT_0 - Antitoxin
- (89415) 89415..89476 - 62 NuclAT_0 - Antitoxin
- (89415) 89415..89476 - 62 NuclAT_0 - Antitoxin
QUE55_RS01525 (89520) 89520..89669 + 150 WP_001312851.1 Hok/Gef family protein Toxin
QUE55_RS01530 (89953) 89953..90210 + 258 WP_001541895.1 replication regulatory protein RepA -
QUE55_RS01535 (90442) 90442..90516 + 75 WP_061357229.1 RepA leader peptide Tap -
QUE55_RS01540 (90509) 90509..91366 + 858 WP_061583826.1 incFII family plasmid replication initiator RepA -
QUE55_RS01545 (92308) 92308..92961 + 654 WP_000616800.1 type II CAAX endopeptidase family protein -
QUE55_RS01550 (93054) 93054..93311 + 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
QUE55_RS01555 (93244) 93244..93645 + 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid dfrA12 / aadA2 / cmlA1 / mcr-5.1 / blaTEM-1B - 1..98615 98615


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T44103 WP_001312851.1 NZ_AP027444:89520-89669 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

>T44103 NZ_AP027444:89520-89669 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACTGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGAGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT44103 NZ_AP027444:c89476-89415 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References