Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 38211..38475 | Replicon | plasmid pEC571_1 |
| Accession | NZ_AP027435 | ||
| Organism | Escherichia coli strain EC571 isolate EC571 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | QUE57_RS01080 | Protein ID | WP_001331364.1 |
| Coordinates | 38323..38475 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 38211..38273 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QUE57_RS01065 (33450) | 33450..35741 | - | 2292 | WP_137653291.1 | F-type conjugative transfer protein TrbC | - |
| QUE57_RS01070 (35734) | 35734..36804 | - | 1071 | WP_137653290.1 | IncI1-type conjugal transfer protein TrbB | - |
| QUE57_RS01075 (36823) | 36823..38031 | - | 1209 | WP_024171190.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (38211) | 38211..38273 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (38211) | 38211..38273 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (38211) | 38211..38273 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (38211) | 38211..38273 | - | 63 | NuclAT_0 | - | Antitoxin |
| QUE57_RS01080 (38323) | 38323..38475 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| QUE57_RS01085 (38547) | 38547..38798 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| QUE57_RS01090 (39297) | 39297..39392 | + | 96 | WP_281506735.1 | DinQ-like type I toxin DqlB | - |
| QUE57_RS01095 (39457) | 39457..39633 | - | 177 | WP_001054897.1 | hypothetical protein | - |
| QUE57_RS01100 (40025) | 40025..40234 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| QUE57_RS01105 (40306) | 40306..40956 | - | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| QUE57_RS01110 (41030) | 41030..43198 | - | 2169 | WP_206975440.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..84551 | 84551 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T44039 WP_001331364.1 NZ_AP027435:38323-38475 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T44039 NZ_AP027435:38323-38475 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT44039 NZ_AP027435:c38273-38211 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|