Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 38224..38488 | Replicon | plasmid pEC581_2 |
Accession | NZ_AP027430 | ||
Organism | Escherichia coli strain EC581 isolate EC581 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Y6M3 |
Locus tag | QUE97_RS01080 | Protein ID | WP_001331364.1 |
Coordinates | 38336..38488 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 38224..38286 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QUE97_RS01065 (33463) | 33463..35754 | - | 2292 | WP_137653291.1 | F-type conjugative transfer protein TrbC | - |
QUE97_RS01070 (35747) | 35747..36817 | - | 1071 | WP_137653290.1 | IncI1-type conjugal transfer protein TrbB | - |
QUE97_RS01075 (36836) | 36836..38044 | - | 1209 | WP_024171190.1 | IncI1-type conjugal transfer protein TrbA | - |
- (38224) | 38224..38286 | - | 63 | NuclAT_0 | - | Antitoxin |
- (38224) | 38224..38286 | - | 63 | NuclAT_0 | - | Antitoxin |
- (38224) | 38224..38286 | - | 63 | NuclAT_0 | - | Antitoxin |
- (38224) | 38224..38286 | - | 63 | NuclAT_0 | - | Antitoxin |
QUE97_RS01080 (38336) | 38336..38488 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
QUE97_RS01085 (38560) | 38560..38811 | - | 252 | WP_001291964.1 | hypothetical protein | - |
QUE97_RS01090 (39310) | 39310..39405 | + | 96 | WP_281506735.1 | DinQ-like type I toxin DqlB | - |
QUE97_RS01095 (39470) | 39470..39646 | - | 177 | WP_001054897.1 | hypothetical protein | - |
QUE97_RS01100 (40038) | 40038..40247 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
QUE97_RS01105 (40319) | 40319..40969 | - | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
QUE97_RS01110 (41043) | 41043..43211 | - | 2169 | WP_206975440.1 | DotA/TraY family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..83702 | 83702 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T44008 WP_001331364.1 NZ_AP027430:38336-38488 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T44008 NZ_AP027430:38336-38488 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT44008 NZ_AP027430:c38286-38224 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|