Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 45891..46145 Replicon plasmid pB27_1
Accession NZ_AP027425
Organism Escherichia coli strain B27 isolate B27

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag QUE78_RS23340 Protein ID WP_001312851.1
Coordinates 45891..46040 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 46084..46145 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QUE78_RS23305 (41912) 41912..42412 + 501 Protein_46 Tn3 family transposase -
QUE78_RS23310 (42446) 42446..42634 + 189 Protein_47 IS3 family transposase -
QUE78_RS23315 (42709) 42709..42996 - 288 WP_000222766.1 type II toxin-antitoxin system RelE/ParE family toxin -
QUE78_RS23320 (42993) 42993..43244 - 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
QUE78_RS23325 (44210) 44210..45067 - 858 WP_039002220.1 incFII family plasmid replication initiator RepA -
QUE78_RS23330 (45060) 45060..45134 - 75 WP_061357229.1 RepA leader peptide Tap -
QUE78_RS23335 (45366) 45366..45623 - 258 WP_001541895.1 replication regulatory protein RepA -
QUE78_RS23340 (45891) 45891..46040 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (46084) 46084..46145 + 62 NuclAT_2 - Antitoxin
- (46084) 46084..46145 + 62 NuclAT_2 - Antitoxin
- (46084) 46084..46145 + 62 NuclAT_2 - Antitoxin
- (46084) 46084..46145 + 62 NuclAT_2 - Antitoxin
QUE78_RS23345 (46487) 46487..46699 - 213 WP_001541896.1 ANR family transcriptional regulator -
QUE78_RS23350 (46834) 46834..47394 - 561 WP_000139310.1 fertility inhibition protein FinO -
QUE78_RS23355 (47449) 47449..48192 - 744 WP_039002216.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCMY-2 / aac(3)-IId / mcr-3.1 / mph(A) - 1..133820 133820


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T43995 WP_001312851.1 NZ_AP027425:c46040-45891 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

>T43995 NZ_AP027425:c46040-45891 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACTGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGAGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT43995 NZ_AP027425:46084-46145 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References