Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-istR/Ldr(toxin) |
| Location | 1871922..1872144 | Replicon | chromosome |
| Accession | NZ_AP027423 | ||
| Organism | Escherichia coli strain EC261 isolate EC261 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | B7LGX8 |
| Locus tag | QUE58_RS11500 | Protein ID | WP_000170965.1 |
| Coordinates | 1871922..1872029 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | istR | ||
| Locus tag | - | ||
| Coordinates | 1872077..1872144 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QUE58_RS11470 (1867231) | 1867231..1868313 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| QUE58_RS11475 (1868313) | 1868313..1869146 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| QUE58_RS11480 (1869143) | 1869143..1869535 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| QUE58_RS11485 (1869539) | 1869539..1870348 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| QUE58_RS11490 (1870384) | 1870384..1871238 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| QUE58_RS11495 (1871387) | 1871387..1871494 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1871544) | 1871544..1871607 | + | 64 | NuclAT_33 | - | - |
| - (1871544) | 1871544..1871607 | + | 64 | NuclAT_33 | - | - |
| - (1871544) | 1871544..1871607 | + | 64 | NuclAT_33 | - | - |
| - (1871544) | 1871544..1871607 | + | 64 | NuclAT_33 | - | - |
| - (1871544) | 1871544..1871607 | + | 64 | NuclAT_34 | - | - |
| - (1871544) | 1871544..1871607 | + | 64 | NuclAT_34 | - | - |
| - (1871544) | 1871544..1871607 | + | 64 | NuclAT_34 | - | - |
| - (1871544) | 1871544..1871607 | + | 64 | NuclAT_34 | - | - |
| - (1871542) | 1871542..1871608 | + | 67 | NuclAT_27 | - | - |
| - (1871542) | 1871542..1871608 | + | 67 | NuclAT_27 | - | - |
| - (1871542) | 1871542..1871608 | + | 67 | NuclAT_27 | - | - |
| - (1871542) | 1871542..1871608 | + | 67 | NuclAT_27 | - | - |
| - (1871542) | 1871542..1871608 | + | 67 | NuclAT_28 | - | - |
| - (1871542) | 1871542..1871608 | + | 67 | NuclAT_28 | - | - |
| - (1871542) | 1871542..1871608 | + | 67 | NuclAT_28 | - | - |
| - (1871542) | 1871542..1871608 | + | 67 | NuclAT_28 | - | - |
| - (1871542) | 1871542..1871608 | + | 67 | NuclAT_29 | - | - |
| - (1871542) | 1871542..1871608 | + | 67 | NuclAT_29 | - | - |
| - (1871542) | 1871542..1871608 | + | 67 | NuclAT_29 | - | - |
| - (1871542) | 1871542..1871608 | + | 67 | NuclAT_29 | - | - |
| - (1871542) | 1871542..1871608 | + | 67 | NuclAT_30 | - | - |
| - (1871542) | 1871542..1871608 | + | 67 | NuclAT_30 | - | - |
| - (1871542) | 1871542..1871608 | + | 67 | NuclAT_30 | - | - |
| - (1871542) | 1871542..1871608 | + | 67 | NuclAT_30 | - | - |
| - (1871542) | 1871542..1871608 | + | 67 | NuclAT_31 | - | - |
| - (1871542) | 1871542..1871608 | + | 67 | NuclAT_31 | - | - |
| - (1871542) | 1871542..1871608 | + | 67 | NuclAT_31 | - | - |
| - (1871542) | 1871542..1871608 | + | 67 | NuclAT_31 | - | - |
| - (1871542) | 1871542..1871608 | + | 67 | NuclAT_32 | - | - |
| - (1871542) | 1871542..1871608 | + | 67 | NuclAT_32 | - | - |
| - (1871542) | 1871542..1871608 | + | 67 | NuclAT_32 | - | - |
| - (1871542) | 1871542..1871608 | + | 67 | NuclAT_32 | - | - |
| QUE58_RS11500 (1871922) | 1871922..1872029 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (1872077) | 1872077..1872144 | + | 68 | NuclAT_15 | - | Antitoxin |
| - (1872077) | 1872077..1872144 | + | 68 | NuclAT_15 | - | Antitoxin |
| - (1872077) | 1872077..1872144 | + | 68 | NuclAT_15 | - | Antitoxin |
| - (1872077) | 1872077..1872144 | + | 68 | NuclAT_15 | - | Antitoxin |
| - (1872077) | 1872077..1872144 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (1872077) | 1872077..1872144 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (1872077) | 1872077..1872144 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (1872077) | 1872077..1872144 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (1872077) | 1872077..1872144 | + | 68 | NuclAT_19 | - | Antitoxin |
| - (1872077) | 1872077..1872144 | + | 68 | NuclAT_19 | - | Antitoxin |
| - (1872077) | 1872077..1872144 | + | 68 | NuclAT_19 | - | Antitoxin |
| - (1872077) | 1872077..1872144 | + | 68 | NuclAT_19 | - | Antitoxin |
| - (1872077) | 1872077..1872144 | + | 68 | NuclAT_21 | - | Antitoxin |
| - (1872077) | 1872077..1872144 | + | 68 | NuclAT_21 | - | Antitoxin |
| - (1872077) | 1872077..1872144 | + | 68 | NuclAT_21 | - | Antitoxin |
| - (1872077) | 1872077..1872144 | + | 68 | NuclAT_21 | - | Antitoxin |
| - (1872077) | 1872077..1872144 | + | 68 | NuclAT_23 | - | Antitoxin |
| - (1872077) | 1872077..1872144 | + | 68 | NuclAT_23 | - | Antitoxin |
| - (1872077) | 1872077..1872144 | + | 68 | NuclAT_23 | - | Antitoxin |
| - (1872077) | 1872077..1872144 | + | 68 | NuclAT_23 | - | Antitoxin |
| - (1872077) | 1872077..1872144 | + | 68 | NuclAT_25 | - | Antitoxin |
| - (1872077) | 1872077..1872144 | + | 68 | NuclAT_25 | - | Antitoxin |
| - (1872077) | 1872077..1872144 | + | 68 | NuclAT_25 | - | Antitoxin |
| - (1872077) | 1872077..1872144 | + | 68 | NuclAT_25 | - | Antitoxin |
| QUE58_RS11505 (1872457) | 1872457..1872564 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1872612) | 1872612..1872679 | + | 68 | NuclAT_16 | - | - |
| - (1872612) | 1872612..1872679 | + | 68 | NuclAT_16 | - | - |
| - (1872612) | 1872612..1872679 | + | 68 | NuclAT_16 | - | - |
| - (1872612) | 1872612..1872679 | + | 68 | NuclAT_16 | - | - |
| - (1872612) | 1872612..1872679 | + | 68 | NuclAT_18 | - | - |
| - (1872612) | 1872612..1872679 | + | 68 | NuclAT_18 | - | - |
| - (1872612) | 1872612..1872679 | + | 68 | NuclAT_18 | - | - |
| - (1872612) | 1872612..1872679 | + | 68 | NuclAT_18 | - | - |
| - (1872612) | 1872612..1872679 | + | 68 | NuclAT_20 | - | - |
| - (1872612) | 1872612..1872679 | + | 68 | NuclAT_20 | - | - |
| - (1872612) | 1872612..1872679 | + | 68 | NuclAT_20 | - | - |
| - (1872612) | 1872612..1872679 | + | 68 | NuclAT_20 | - | - |
| - (1872612) | 1872612..1872679 | + | 68 | NuclAT_22 | - | - |
| - (1872612) | 1872612..1872679 | + | 68 | NuclAT_22 | - | - |
| - (1872612) | 1872612..1872679 | + | 68 | NuclAT_22 | - | - |
| - (1872612) | 1872612..1872679 | + | 68 | NuclAT_22 | - | - |
| - (1872612) | 1872612..1872679 | + | 68 | NuclAT_24 | - | - |
| - (1872612) | 1872612..1872679 | + | 68 | NuclAT_24 | - | - |
| - (1872612) | 1872612..1872679 | + | 68 | NuclAT_24 | - | - |
| - (1872612) | 1872612..1872679 | + | 68 | NuclAT_24 | - | - |
| - (1872612) | 1872612..1872679 | + | 68 | NuclAT_26 | - | - |
| - (1872612) | 1872612..1872679 | + | 68 | NuclAT_26 | - | - |
| - (1872612) | 1872612..1872679 | + | 68 | NuclAT_26 | - | - |
| - (1872612) | 1872612..1872679 | + | 68 | NuclAT_26 | - | - |
| QUE58_RS11510 (1872969) | 1872969..1874069 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| QUE58_RS11515 (1874339) | 1874339..1874569 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| QUE58_RS11520 (1874727) | 1874727..1875422 | + | 696 | WP_001355927.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| QUE58_RS11525 (1875466) | 1875466..1875819 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T43947 WP_000170965.1 NZ_AP027423:c1872029-1871922 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T43947 NZ_AP027423:c1872029-1871922 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 68 bp
>AT43947 NZ_AP027423:1872077-1872144 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|