Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-istR/Ldr(toxin)
Location 1871922..1872144 Replicon chromosome
Accession NZ_AP027423
Organism Escherichia coli strain EC261 isolate EC261

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag QUE58_RS11500 Protein ID WP_000170965.1
Coordinates 1871922..1872029 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name istR
Locus tag -
Coordinates 1872077..1872144 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QUE58_RS11470 (1867231) 1867231..1868313 + 1083 WP_000804726.1 peptide chain release factor 1 -
QUE58_RS11475 (1868313) 1868313..1869146 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
QUE58_RS11480 (1869143) 1869143..1869535 + 393 WP_000200378.1 invasion regulator SirB2 -
QUE58_RS11485 (1869539) 1869539..1870348 + 810 WP_001257044.1 invasion regulator SirB1 -
QUE58_RS11490 (1870384) 1870384..1871238 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QUE58_RS11495 (1871387) 1871387..1871494 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1871544) 1871544..1871607 + 64 NuclAT_33 - -
- (1871544) 1871544..1871607 + 64 NuclAT_33 - -
- (1871544) 1871544..1871607 + 64 NuclAT_33 - -
- (1871544) 1871544..1871607 + 64 NuclAT_33 - -
- (1871544) 1871544..1871607 + 64 NuclAT_34 - -
- (1871544) 1871544..1871607 + 64 NuclAT_34 - -
- (1871544) 1871544..1871607 + 64 NuclAT_34 - -
- (1871544) 1871544..1871607 + 64 NuclAT_34 - -
- (1871542) 1871542..1871608 + 67 NuclAT_27 - -
- (1871542) 1871542..1871608 + 67 NuclAT_27 - -
- (1871542) 1871542..1871608 + 67 NuclAT_27 - -
- (1871542) 1871542..1871608 + 67 NuclAT_27 - -
- (1871542) 1871542..1871608 + 67 NuclAT_28 - -
- (1871542) 1871542..1871608 + 67 NuclAT_28 - -
- (1871542) 1871542..1871608 + 67 NuclAT_28 - -
- (1871542) 1871542..1871608 + 67 NuclAT_28 - -
- (1871542) 1871542..1871608 + 67 NuclAT_29 - -
- (1871542) 1871542..1871608 + 67 NuclAT_29 - -
- (1871542) 1871542..1871608 + 67 NuclAT_29 - -
- (1871542) 1871542..1871608 + 67 NuclAT_29 - -
- (1871542) 1871542..1871608 + 67 NuclAT_30 - -
- (1871542) 1871542..1871608 + 67 NuclAT_30 - -
- (1871542) 1871542..1871608 + 67 NuclAT_30 - -
- (1871542) 1871542..1871608 + 67 NuclAT_30 - -
- (1871542) 1871542..1871608 + 67 NuclAT_31 - -
- (1871542) 1871542..1871608 + 67 NuclAT_31 - -
- (1871542) 1871542..1871608 + 67 NuclAT_31 - -
- (1871542) 1871542..1871608 + 67 NuclAT_31 - -
- (1871542) 1871542..1871608 + 67 NuclAT_32 - -
- (1871542) 1871542..1871608 + 67 NuclAT_32 - -
- (1871542) 1871542..1871608 + 67 NuclAT_32 - -
- (1871542) 1871542..1871608 + 67 NuclAT_32 - -
QUE58_RS11500 (1871922) 1871922..1872029 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1872077) 1872077..1872144 + 68 NuclAT_15 - Antitoxin
- (1872077) 1872077..1872144 + 68 NuclAT_15 - Antitoxin
- (1872077) 1872077..1872144 + 68 NuclAT_15 - Antitoxin
- (1872077) 1872077..1872144 + 68 NuclAT_15 - Antitoxin
- (1872077) 1872077..1872144 + 68 NuclAT_17 - Antitoxin
- (1872077) 1872077..1872144 + 68 NuclAT_17 - Antitoxin
- (1872077) 1872077..1872144 + 68 NuclAT_17 - Antitoxin
- (1872077) 1872077..1872144 + 68 NuclAT_17 - Antitoxin
- (1872077) 1872077..1872144 + 68 NuclAT_19 - Antitoxin
- (1872077) 1872077..1872144 + 68 NuclAT_19 - Antitoxin
- (1872077) 1872077..1872144 + 68 NuclAT_19 - Antitoxin
- (1872077) 1872077..1872144 + 68 NuclAT_19 - Antitoxin
- (1872077) 1872077..1872144 + 68 NuclAT_21 - Antitoxin
- (1872077) 1872077..1872144 + 68 NuclAT_21 - Antitoxin
- (1872077) 1872077..1872144 + 68 NuclAT_21 - Antitoxin
- (1872077) 1872077..1872144 + 68 NuclAT_21 - Antitoxin
- (1872077) 1872077..1872144 + 68 NuclAT_23 - Antitoxin
- (1872077) 1872077..1872144 + 68 NuclAT_23 - Antitoxin
- (1872077) 1872077..1872144 + 68 NuclAT_23 - Antitoxin
- (1872077) 1872077..1872144 + 68 NuclAT_23 - Antitoxin
- (1872077) 1872077..1872144 + 68 NuclAT_25 - Antitoxin
- (1872077) 1872077..1872144 + 68 NuclAT_25 - Antitoxin
- (1872077) 1872077..1872144 + 68 NuclAT_25 - Antitoxin
- (1872077) 1872077..1872144 + 68 NuclAT_25 - Antitoxin
QUE58_RS11505 (1872457) 1872457..1872564 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1872612) 1872612..1872679 + 68 NuclAT_16 - -
- (1872612) 1872612..1872679 + 68 NuclAT_16 - -
- (1872612) 1872612..1872679 + 68 NuclAT_16 - -
- (1872612) 1872612..1872679 + 68 NuclAT_16 - -
- (1872612) 1872612..1872679 + 68 NuclAT_18 - -
- (1872612) 1872612..1872679 + 68 NuclAT_18 - -
- (1872612) 1872612..1872679 + 68 NuclAT_18 - -
- (1872612) 1872612..1872679 + 68 NuclAT_18 - -
- (1872612) 1872612..1872679 + 68 NuclAT_20 - -
- (1872612) 1872612..1872679 + 68 NuclAT_20 - -
- (1872612) 1872612..1872679 + 68 NuclAT_20 - -
- (1872612) 1872612..1872679 + 68 NuclAT_20 - -
- (1872612) 1872612..1872679 + 68 NuclAT_22 - -
- (1872612) 1872612..1872679 + 68 NuclAT_22 - -
- (1872612) 1872612..1872679 + 68 NuclAT_22 - -
- (1872612) 1872612..1872679 + 68 NuclAT_22 - -
- (1872612) 1872612..1872679 + 68 NuclAT_24 - -
- (1872612) 1872612..1872679 + 68 NuclAT_24 - -
- (1872612) 1872612..1872679 + 68 NuclAT_24 - -
- (1872612) 1872612..1872679 + 68 NuclAT_24 - -
- (1872612) 1872612..1872679 + 68 NuclAT_26 - -
- (1872612) 1872612..1872679 + 68 NuclAT_26 - -
- (1872612) 1872612..1872679 + 68 NuclAT_26 - -
- (1872612) 1872612..1872679 + 68 NuclAT_26 - -
QUE58_RS11510 (1872969) 1872969..1874069 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
QUE58_RS11515 (1874339) 1874339..1874569 + 231 WP_001146442.1 putative cation transport regulator ChaB -
QUE58_RS11520 (1874727) 1874727..1875422 + 696 WP_001355927.1 glutathione-specific gamma-glutamylcyclotransferase -
QUE58_RS11525 (1875466) 1875466..1875819 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T43947 WP_000170965.1 NZ_AP027423:c1872029-1871922 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T43947 NZ_AP027423:c1872029-1871922 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT43947 NZ_AP027423:1872077-1872144 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References