Detailed information of TA system TA043927

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 47988..48257
• Replicon: plasmid pEC261_3
• Accession: NZ_AP027420
• Organism: Escherichia coli strain EC261 isolate EC261

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QUE58_RS00340
• Protein ID: WP_001372321.1
• Coordinates: 48132..48257 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	47988..48053 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QUE58_RS00295	43049..43282	+	234	WP_071588969.1	hypothetical protein	-
QUE58_RS00300	43523..43729	+	207	WP_073520019.1	single-stranded DNA-binding protein	-
QUE58_RS00305	43755..44294	+	540	WP_000290841.1	single-stranded DNA-binding protein	-
QUE58_RS00310	44357..44590	+	234	WP_087086828.1	DUF905 family protein	-
QUE58_RS00315	44656..46614	+	1959	WP_099357091.1	ParB/RepB/Spo0J family partition protein	-
QUE58_RS00320	46669..47103	+	435	WP_042634413.1	conjugation system SOS inhibitor PsiB	-
QUE58_RS00325	47100..47862	+	763	Protein_64	plasmid SOS inhibition protein A	-
QUE58_RS00330	47831..48019	-	189	WP_001299721.1	hypothetical protein	-
-	47831..48055	+	225	NuclAT_0	-	-
-	47831..48055	+	225	NuclAT_0	-	-
-	47831..48055	+	225	NuclAT_0	-	-
-	47831..48055	+	225	NuclAT_0	-	-
-	47988..48053	+	66	-	-	Antitoxin
QUE58_RS00335	48041..48190	+	150	Protein_66	plasmid maintenance protein Mok	-
QUE58_RS00340	48132..48257	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QUE58_RS00345	48704..48877	-	174	Protein_68	hypothetical protein	-
QUE58_RS00350	48947..49153	+	207	WP_000547968.1	hypothetical protein	-
QUE58_RS00355	49178..49465	+	288	WP_000107535.1	hypothetical protein	-
QUE58_RS00360	49583..50404	+	822	WP_286347894.1	DUF932 domain-containing protein	-
QUE58_RS00365	50701..51348	-	648	WP_000614935.1	transglycosylase SLT domain-containing protein	-
QUE58_RS00370	51625..52008	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QUE58_RS00375	52198..52884	+	687	WP_073520017.1	PAS domain-containing protein	-
QUE58_RS00380	52978..53205	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaTEM-1B / aph(6)-Id / aph(3'')-Ib / dfrA12 / aadA2	-	1..83405	83405

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T43927 WP_001372321.1 NZ_AP027420:48132-48257 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T43927 NZ_AP027420:48132-48257 [Escherichia coli]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT43927 NZ_AP027420:47988-48053 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC

Structures

Antitoxin