Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 214494..214715 Replicon chromosome
Accession NZ_AP027417
Organism Escherichia coli strain EC361 isolate EC361

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag QUF17_RS04285 Protein ID WP_000170954.1
Coordinates 214494..214601 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 214649..214715 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QUF17_RS04260 (210338) 210338..211420 + 1083 WP_000804726.1 peptide chain release factor 1 -
QUF17_RS04265 (211420) 211420..212253 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
QUF17_RS04270 (212250) 212250..212642 + 393 WP_000200378.1 invasion regulator SirB2 -
QUF17_RS04275 (212646) 212646..213455 + 810 WP_001257044.1 invasion regulator SirB1 -
QUF17_RS04280 (213491) 213491..214345 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QUF17_RS04285 (214494) 214494..214601 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (214651) 214651..214714 + 64 NuclAT_39 - -
- (214651) 214651..214714 + 64 NuclAT_39 - -
- (214651) 214651..214714 + 64 NuclAT_39 - -
- (214651) 214651..214714 + 64 NuclAT_39 - -
- (214651) 214651..214714 + 64 NuclAT_41 - -
- (214651) 214651..214714 + 64 NuclAT_41 - -
- (214651) 214651..214714 + 64 NuclAT_41 - -
- (214651) 214651..214714 + 64 NuclAT_41 - -
- (214649) 214649..214715 + 67 NuclAT_26 - Antitoxin
- (214649) 214649..214715 + 67 NuclAT_26 - Antitoxin
- (214649) 214649..214715 + 67 NuclAT_26 - Antitoxin
- (214649) 214649..214715 + 67 NuclAT_26 - Antitoxin
- (214649) 214649..214715 + 67 NuclAT_28 - Antitoxin
- (214649) 214649..214715 + 67 NuclAT_28 - Antitoxin
- (214649) 214649..214715 + 67 NuclAT_28 - Antitoxin
- (214649) 214649..214715 + 67 NuclAT_28 - Antitoxin
- (214649) 214649..214715 + 67 NuclAT_30 - Antitoxin
- (214649) 214649..214715 + 67 NuclAT_30 - Antitoxin
- (214649) 214649..214715 + 67 NuclAT_30 - Antitoxin
- (214649) 214649..214715 + 67 NuclAT_30 - Antitoxin
- (214649) 214649..214715 + 67 NuclAT_32 - Antitoxin
- (214649) 214649..214715 + 67 NuclAT_32 - Antitoxin
- (214649) 214649..214715 + 67 NuclAT_32 - Antitoxin
- (214649) 214649..214715 + 67 NuclAT_32 - Antitoxin
- (214649) 214649..214715 + 67 NuclAT_34 - Antitoxin
- (214649) 214649..214715 + 67 NuclAT_34 - Antitoxin
- (214649) 214649..214715 + 67 NuclAT_34 - Antitoxin
- (214649) 214649..214715 + 67 NuclAT_34 - Antitoxin
- (214649) 214649..214715 + 67 NuclAT_36 - Antitoxin
- (214649) 214649..214715 + 67 NuclAT_36 - Antitoxin
- (214649) 214649..214715 + 67 NuclAT_36 - Antitoxin
- (214649) 214649..214715 + 67 NuclAT_36 - Antitoxin
QUF17_RS04290 (215029) 215029..215136 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- (215189) 215189..215250 + 62 NuclAT_38 - -
- (215189) 215189..215250 + 62 NuclAT_38 - -
- (215189) 215189..215250 + 62 NuclAT_38 - -
- (215189) 215189..215250 + 62 NuclAT_38 - -
- (215189) 215189..215250 + 62 NuclAT_40 - -
- (215189) 215189..215250 + 62 NuclAT_40 - -
- (215189) 215189..215250 + 62 NuclAT_40 - -
- (215189) 215189..215250 + 62 NuclAT_40 - -
- (215189) 215189..215251 + 63 NuclAT_27 - -
- (215189) 215189..215251 + 63 NuclAT_27 - -
- (215189) 215189..215251 + 63 NuclAT_27 - -
- (215189) 215189..215251 + 63 NuclAT_27 - -
- (215189) 215189..215251 + 63 NuclAT_29 - -
- (215189) 215189..215251 + 63 NuclAT_29 - -
- (215189) 215189..215251 + 63 NuclAT_29 - -
- (215189) 215189..215251 + 63 NuclAT_29 - -
- (215189) 215189..215251 + 63 NuclAT_31 - -
- (215189) 215189..215251 + 63 NuclAT_31 - -
- (215189) 215189..215251 + 63 NuclAT_31 - -
- (215189) 215189..215251 + 63 NuclAT_31 - -
- (215189) 215189..215251 + 63 NuclAT_33 - -
- (215189) 215189..215251 + 63 NuclAT_33 - -
- (215189) 215189..215251 + 63 NuclAT_33 - -
- (215189) 215189..215251 + 63 NuclAT_33 - -
- (215189) 215189..215251 + 63 NuclAT_35 - -
- (215189) 215189..215251 + 63 NuclAT_35 - -
- (215189) 215189..215251 + 63 NuclAT_35 - -
- (215189) 215189..215251 + 63 NuclAT_35 - -
- (215189) 215189..215251 + 63 NuclAT_37 - -
- (215189) 215189..215251 + 63 NuclAT_37 - -
- (215189) 215189..215251 + 63 NuclAT_37 - -
- (215189) 215189..215251 + 63 NuclAT_37 - -
- (215189) 215189..215252 + 64 NuclAT_15 - -
- (215189) 215189..215252 + 64 NuclAT_15 - -
- (215189) 215189..215252 + 64 NuclAT_15 - -
- (215189) 215189..215252 + 64 NuclAT_15 - -
- (215189) 215189..215252 + 64 NuclAT_17 - -
- (215189) 215189..215252 + 64 NuclAT_17 - -
- (215189) 215189..215252 + 64 NuclAT_17 - -
- (215189) 215189..215252 + 64 NuclAT_17 - -
- (215189) 215189..215252 + 64 NuclAT_19 - -
- (215189) 215189..215252 + 64 NuclAT_19 - -
- (215189) 215189..215252 + 64 NuclAT_19 - -
- (215189) 215189..215252 + 64 NuclAT_19 - -
- (215189) 215189..215252 + 64 NuclAT_21 - -
- (215189) 215189..215252 + 64 NuclAT_21 - -
- (215189) 215189..215252 + 64 NuclAT_21 - -
- (215189) 215189..215252 + 64 NuclAT_21 - -
- (215189) 215189..215252 + 64 NuclAT_23 - -
- (215189) 215189..215252 + 64 NuclAT_23 - -
- (215189) 215189..215252 + 64 NuclAT_23 - -
- (215189) 215189..215252 + 64 NuclAT_23 - -
- (215189) 215189..215252 + 64 NuclAT_25 - -
- (215189) 215189..215252 + 64 NuclAT_25 - -
- (215189) 215189..215252 + 64 NuclAT_25 - -
- (215189) 215189..215252 + 64 NuclAT_25 - -
QUF17_RS04295 (215575) 215575..215715 - 141 WP_286338187.1 hypothetical protein -
- (215736) 215736..215803 + 68 NuclAT_14 - -
- (215736) 215736..215803 + 68 NuclAT_14 - -
- (215736) 215736..215803 + 68 NuclAT_14 - -
- (215736) 215736..215803 + 68 NuclAT_14 - -
- (215736) 215736..215803 + 68 NuclAT_16 - -
- (215736) 215736..215803 + 68 NuclAT_16 - -
- (215736) 215736..215803 + 68 NuclAT_16 - -
- (215736) 215736..215803 + 68 NuclAT_16 - -
- (215736) 215736..215803 + 68 NuclAT_18 - -
- (215736) 215736..215803 + 68 NuclAT_18 - -
- (215736) 215736..215803 + 68 NuclAT_18 - -
- (215736) 215736..215803 + 68 NuclAT_18 - -
- (215736) 215736..215803 + 68 NuclAT_20 - -
- (215736) 215736..215803 + 68 NuclAT_20 - -
- (215736) 215736..215803 + 68 NuclAT_20 - -
- (215736) 215736..215803 + 68 NuclAT_20 - -
- (215736) 215736..215803 + 68 NuclAT_22 - -
- (215736) 215736..215803 + 68 NuclAT_22 - -
- (215736) 215736..215803 + 68 NuclAT_22 - -
- (215736) 215736..215803 + 68 NuclAT_22 - -
- (215736) 215736..215803 + 68 NuclAT_24 - -
- (215736) 215736..215803 + 68 NuclAT_24 - -
- (215736) 215736..215803 + 68 NuclAT_24 - -
- (215736) 215736..215803 + 68 NuclAT_24 - -
QUF17_RS04300 (216093) 216093..217193 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
QUF17_RS04305 (217463) 217463..217693 + 231 WP_001146442.1 putative cation transport regulator ChaB -
QUF17_RS04310 (217851) 217851..218546 + 696 WP_001355927.1 glutathione-specific gamma-glutamylcyclotransferase -
QUF17_RS04315 (218590) 218590..218943 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T43868 WP_000170954.1 NZ_AP027417:c214601-214494 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T43868 NZ_AP027417:c214601-214494 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT43868 NZ_AP027417:214649-214715 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References