Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 1726115..1726336 Replicon chromosome
Accession NZ_AP027408
Organism Escherichia coli strain EC507 isolate EC507

Toxin (Protein)


Gene name ldrD Uniprot ID -
Locus tag QUE45_RS09575 Protein ID WP_074155482.1
Coordinates 1726115..1726222 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 1726270..1726336 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QUE45_RS09545 (1721426) 1721426..1722508 + 1083 WP_000804726.1 peptide chain release factor 1 -
QUE45_RS09550 (1722508) 1722508..1723341 + 834 WP_000456454.1 peptide chain release factor N(5)-glutamine methyltransferase -
QUE45_RS09555 (1723338) 1723338..1723730 + 393 WP_001409175.1 invasion regulator SirB2 -
QUE45_RS09560 (1723734) 1723734..1724543 + 810 WP_001257044.1 invasion regulator SirB1 -
QUE45_RS09565 (1724579) 1724579..1725433 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QUE45_RS09570 (1725580) 1725580..1725687 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1725735) 1725735..1725800 + 66 NuclAT_25 - -
- (1725735) 1725735..1725800 + 66 NuclAT_25 - -
- (1725735) 1725735..1725800 + 66 NuclAT_25 - -
- (1725735) 1725735..1725800 + 66 NuclAT_25 - -
- (1725735) 1725735..1725800 + 66 NuclAT_27 - -
- (1725735) 1725735..1725800 + 66 NuclAT_27 - -
- (1725735) 1725735..1725800 + 66 NuclAT_27 - -
- (1725735) 1725735..1725800 + 66 NuclAT_27 - -
- (1725735) 1725735..1725800 + 66 NuclAT_29 - -
- (1725735) 1725735..1725800 + 66 NuclAT_29 - -
- (1725735) 1725735..1725800 + 66 NuclAT_29 - -
- (1725735) 1725735..1725800 + 66 NuclAT_29 - -
- (1725735) 1725735..1725800 + 66 NuclAT_31 - -
- (1725735) 1725735..1725800 + 66 NuclAT_31 - -
- (1725735) 1725735..1725800 + 66 NuclAT_31 - -
- (1725735) 1725735..1725800 + 66 NuclAT_31 - -
- (1725735) 1725735..1725800 + 66 NuclAT_34 - -
- (1725735) 1725735..1725800 + 66 NuclAT_34 - -
- (1725735) 1725735..1725800 + 66 NuclAT_34 - -
- (1725735) 1725735..1725800 + 66 NuclAT_34 - -
- (1725735) 1725735..1725800 + 66 NuclAT_36 - -
- (1725735) 1725735..1725800 + 66 NuclAT_36 - -
- (1725735) 1725735..1725800 + 66 NuclAT_36 - -
- (1725735) 1725735..1725800 + 66 NuclAT_36 - -
- (1725736) 1725736..1725801 + 66 NuclAT_13 - -
- (1725736) 1725736..1725801 + 66 NuclAT_13 - -
- (1725736) 1725736..1725801 + 66 NuclAT_13 - -
- (1725736) 1725736..1725801 + 66 NuclAT_13 - -
- (1725736) 1725736..1725801 + 66 NuclAT_15 - -
- (1725736) 1725736..1725801 + 66 NuclAT_15 - -
- (1725736) 1725736..1725801 + 66 NuclAT_15 - -
- (1725736) 1725736..1725801 + 66 NuclAT_15 - -
- (1725736) 1725736..1725801 + 66 NuclAT_17 - -
- (1725736) 1725736..1725801 + 66 NuclAT_17 - -
- (1725736) 1725736..1725801 + 66 NuclAT_17 - -
- (1725736) 1725736..1725801 + 66 NuclAT_17 - -
- (1725736) 1725736..1725801 + 66 NuclAT_19 - -
- (1725736) 1725736..1725801 + 66 NuclAT_19 - -
- (1725736) 1725736..1725801 + 66 NuclAT_19 - -
- (1725736) 1725736..1725801 + 66 NuclAT_19 - -
- (1725736) 1725736..1725801 + 66 NuclAT_21 - -
- (1725736) 1725736..1725801 + 66 NuclAT_21 - -
- (1725736) 1725736..1725801 + 66 NuclAT_21 - -
- (1725736) 1725736..1725801 + 66 NuclAT_21 - -
- (1725736) 1725736..1725801 + 66 NuclAT_23 - -
- (1725736) 1725736..1725801 + 66 NuclAT_23 - -
- (1725736) 1725736..1725801 + 66 NuclAT_23 - -
- (1725736) 1725736..1725801 + 66 NuclAT_23 - -
- (1725735) 1725735..1725802 + 68 NuclAT_38 - -
- (1725735) 1725735..1725802 + 68 NuclAT_38 - -
- (1725735) 1725735..1725802 + 68 NuclAT_38 - -
- (1725735) 1725735..1725802 + 68 NuclAT_38 - -
QUE45_RS09575 (1726115) 1726115..1726222 - 108 WP_074155482.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1726272) 1726272..1726335 + 64 NuclAT_26 - -
- (1726272) 1726272..1726335 + 64 NuclAT_26 - -
- (1726272) 1726272..1726335 + 64 NuclAT_26 - -
- (1726272) 1726272..1726335 + 64 NuclAT_26 - -
- (1726272) 1726272..1726335 + 64 NuclAT_28 - -
- (1726272) 1726272..1726335 + 64 NuclAT_28 - -
- (1726272) 1726272..1726335 + 64 NuclAT_28 - -
- (1726272) 1726272..1726335 + 64 NuclAT_28 - -
- (1726272) 1726272..1726335 + 64 NuclAT_30 - -
- (1726272) 1726272..1726335 + 64 NuclAT_30 - -
- (1726272) 1726272..1726335 + 64 NuclAT_30 - -
- (1726272) 1726272..1726335 + 64 NuclAT_30 - -
- (1726272) 1726272..1726335 + 64 NuclAT_32 - -
- (1726272) 1726272..1726335 + 64 NuclAT_32 - -
- (1726272) 1726272..1726335 + 64 NuclAT_32 - -
- (1726272) 1726272..1726335 + 64 NuclAT_32 - -
- (1726272) 1726272..1726335 + 64 NuclAT_35 - -
- (1726272) 1726272..1726335 + 64 NuclAT_35 - -
- (1726272) 1726272..1726335 + 64 NuclAT_35 - -
- (1726272) 1726272..1726335 + 64 NuclAT_35 - -
- (1726272) 1726272..1726335 + 64 NuclAT_37 - -
- (1726272) 1726272..1726335 + 64 NuclAT_37 - -
- (1726272) 1726272..1726335 + 64 NuclAT_37 - -
- (1726272) 1726272..1726335 + 64 NuclAT_37 - -
- (1726270) 1726270..1726336 + 67 NuclAT_12 - Antitoxin
- (1726270) 1726270..1726336 + 67 NuclAT_12 - Antitoxin
- (1726270) 1726270..1726336 + 67 NuclAT_12 - Antitoxin
- (1726270) 1726270..1726336 + 67 NuclAT_12 - Antitoxin
- (1726270) 1726270..1726336 + 67 NuclAT_14 - Antitoxin
- (1726270) 1726270..1726336 + 67 NuclAT_14 - Antitoxin
- (1726270) 1726270..1726336 + 67 NuclAT_14 - Antitoxin
- (1726270) 1726270..1726336 + 67 NuclAT_14 - Antitoxin
- (1726270) 1726270..1726336 + 67 NuclAT_16 - Antitoxin
- (1726270) 1726270..1726336 + 67 NuclAT_16 - Antitoxin
- (1726270) 1726270..1726336 + 67 NuclAT_16 - Antitoxin
- (1726270) 1726270..1726336 + 67 NuclAT_16 - Antitoxin
- (1726270) 1726270..1726336 + 67 NuclAT_18 - Antitoxin
- (1726270) 1726270..1726336 + 67 NuclAT_18 - Antitoxin
- (1726270) 1726270..1726336 + 67 NuclAT_18 - Antitoxin
- (1726270) 1726270..1726336 + 67 NuclAT_18 - Antitoxin
- (1726270) 1726270..1726336 + 67 NuclAT_20 - Antitoxin
- (1726270) 1726270..1726336 + 67 NuclAT_20 - Antitoxin
- (1726270) 1726270..1726336 + 67 NuclAT_20 - Antitoxin
- (1726270) 1726270..1726336 + 67 NuclAT_20 - Antitoxin
- (1726270) 1726270..1726336 + 67 NuclAT_22 - Antitoxin
- (1726270) 1726270..1726336 + 67 NuclAT_22 - Antitoxin
- (1726270) 1726270..1726336 + 67 NuclAT_22 - Antitoxin
- (1726270) 1726270..1726336 + 67 NuclAT_22 - Antitoxin
- (1726272) 1726272..1726337 + 66 NuclAT_39 - -
- (1726272) 1726272..1726337 + 66 NuclAT_39 - -
- (1726272) 1726272..1726337 + 66 NuclAT_39 - -
- (1726272) 1726272..1726337 + 66 NuclAT_39 - -
QUE45_RS09580 (1726627) 1726627..1727727 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
QUE45_RS09585 (1727997) 1727997..1728227 + 231 WP_001146444.1 putative cation transport regulator ChaB -
QUE45_RS09590 (1728385) 1728385..1729068 + 684 WP_124037112.1 glutathione-specific gamma-glutamylcyclotransferase -
QUE45_RS09595 (1729112) 1729112..1729465 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
QUE45_RS09600 (1729651) 1729651..1731045 + 1395 WP_001400233.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3991.77 Da        Isoelectric Point: 9.1413

>T43818 WP_074155482.1 NZ_AP027408:c1726222-1726115 [Escherichia coli]
MTLAQFAMIFWDDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T43818 NZ_AP027408:c1726222-1726115 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGGACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT43818 NZ_AP027408:1726270-1726336 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References