Detailed information of TA system TA043782

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 54522..54791
• Replicon: plasmid pEC416_1
• Accession: NZ_AP027403
• Organism: Escherichia coli strain EC416 isolate EC416

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QUE37_RS00690
• Protein ID: WP_001372321.1
• Coordinates: 54666..54791 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	54522..54587 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QUE37_RS00650 (50070)	50070..50276	+	207	WP_050497023.1	hypothetical protein	-
QUE37_RS00655 (50302)	50302..50841	+	540	WP_286347722.1	single-stranded DNA-binding protein	-
QUE37_RS00660 (50898)	50898..51131	+	234	WP_000006004.1	DUF905 domain-containing protein	-
QUE37_RS00665 (51190)	51190..53148	+	1959	WP_089622489.1	ParB/RepB/Spo0J family partition protein	-
QUE37_RS00670 (53203)	53203..53637	+	435	WP_089622488.1	conjugation system SOS inhibitor PsiB	-
QUE37_RS00675 (53634)	53634..54396	+	763	Protein_57	plasmid SOS inhibition protein A	-
QUE37_RS00680 (54365)	54365..54553	-	189	WP_001299721.1	hypothetical protein	-
- (54522)	54522..54587	+	66	NuclAT_1	-	Antitoxin
- (54365)	54365..54589	+	225	NuclAT_0	-	-
- (54365)	54365..54589	+	225	NuclAT_0	-	-
- (54365)	54365..54589	+	225	NuclAT_0	-	-
- (54365)	54365..54589	+	225	NuclAT_0	-	-
- (54365)	54365..54589	-	225	NuclAT_0	-	-
QUE37_RS00685 (54575)	54575..54724	+	150	Protein_59	plasmid maintenance protein Mok	-
QUE37_RS00690 (54666)	54666..54791	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QUE37_RS00695 (55011)	55011..55244	+	234	WP_286347723.1	hypothetical protein	-
QUE37_RS00700 (55242)	55242..55415	-	174	Protein_62	hypothetical protein	-
QUE37_RS00705 (55715)	55715..56002	+	288	WP_196042597.1	hypothetical protein	-
QUE37_RS00710 (56121)	56121..56942	+	822	Protein_64	DUF932 domain-containing protein	-
QUE37_RS00715 (57238)	57238..57828	-	591	WP_199902026.1	transglycosylase SLT domain-containing protein	-
QUE37_RS00720 (58161)	58161..58544	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QUE37_RS00725 (58731)	58731..59420	+	690	WP_000283384.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	-	1..98045	98045

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T43782 WP_001372321.1 NZ_AP027403:54666-54791 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T43782 NZ_AP027403:54666-54791 [Escherichia coli]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT43782 NZ_AP027403:54522-54587 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC

Structures

Antitoxin