Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 856048..856384 | Replicon | chromosome |
Accession | NZ_AP027302 | ||
Organism | Enterococcus faecalis strain N4E |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | QUD80_RS04125 | Protein ID | WP_016619108.1 |
Coordinates | 856241..856384 (-) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 856048..856097 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QUD80_RS04120 (851355) | 851355..856046 | + | 4692 | WP_174114070.1 | WxL domain-containing protein | - |
- (856048) | 856048..856097 | - | 50 | NuclAT_16 | - | Antitoxin |
- (856047) | 856047..856309 | + | 263 | NuclAT_11 | - | - |
QUD80_RS04125 (856241) | 856241..856384 | - | 144 | WP_016619108.1 | putative holin-like toxin | Toxin |
- (856495) | 856495..856641 | + | 147 | NuclAT_12 | - | - |
- (856481) | 856481..856682 | + | 202 | NuclAT_8 | - | - |
QUD80_RS04130 (856615) | 856615..856758 | - | 144 | WP_002389461.1 | type I toxin-antitoxin system toxin PepG1 | - |
QUD80_RS04135 (857093) | 857093..858709 | - | 1617 | WP_174114069.1 | phosphatase PAP2/LCP family protein | - |
QUD80_RS04140 (859395) | 859395..860033 | + | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
QUD80_RS04145 (860200) | 860200..861192 | - | 993 | WP_002378862.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5191.13 Da Isoelectric Point: 8.6626
>T43734 WP_016619108.1 NZ_AP027302:c856384-856241 [Enterococcus faecalis]
MNVSTKTYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
MNVSTKTYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
Download Length: 144 bp
>T43734 NZ_AP027302:c856384-856241 [Enterococcus faecalis]
ATGAATGTAAGTACTAAAACCTATGAAAGGAGAGGCCTTTTGTCTATCGCAGAAGCTTTAGCTCTGATGATTAGTTTCGG
TTCTTTTATCGCAACGTTAATCTTCGGAATCCTAGAGGCTGTTAAAGAAGACAATAAAAAATAA
ATGAATGTAAGTACTAAAACCTATGAAAGGAGAGGCCTTTTGTCTATCGCAGAAGCTTTAGCTCTGATGATTAGTTTCGG
TTCTTTTATCGCAACGTTAATCTTCGGAATCCTAGAGGCTGTTAAAGAAGACAATAAAAAATAA
Antitoxin
Download Length: 50 bp
>AT43734 NZ_AP027302:c856097-856048 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|