Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 447522..447716 | Replicon | chromosome |
Accession | NZ_AP027302 | ||
Organism | Enterococcus faecalis strain N4E |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | QUD80_RS02155 | Protein ID | WP_015543884.1 |
Coordinates | 447522..447617 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 447652..447716 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QUD80_RS02135 (442701) | 442701..443816 | + | 1116 | WP_033785759.1 | FAD-dependent oxidoreductase | - |
QUD80_RS02140 (443883) | 443883..445037 | - | 1155 | WP_002395429.1 | mannitol-1-phosphate 5-dehydrogenase | - |
QUD80_RS02145 (445052) | 445052..445489 | - | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
QUD80_RS02150 (445504) | 445504..447276 | - | 1773 | WP_002387897.1 | PTS mannitol-specific transporter subunit IIBC | - |
QUD80_RS02155 (447522) | 447522..447617 | + | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- (447652) | 447652..447716 | - | 65 | NuclAT_17 | - | Antitoxin |
QUD80_RS02160 (447886) | 447886..448320 | - | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
QUD80_RS02165 (448331) | 448331..450364 | - | 2034 | WP_002361171.1 | PRD domain-containing protein | - |
QUD80_RS02170 (450355) | 450355..452096 | - | 1742 | Protein_430 | PTS transporter subunit EIIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T43731 WP_015543884.1 NZ_AP027302:447522-447617 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T43731 NZ_AP027302:447522-447617 [Enterococcus faecalis]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 65 bp
>AT43731 NZ_AP027302:c447716-447652 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|