Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 1180597..1180791 | Replicon | chromosome |
Accession | NZ_AP027297 | ||
Organism | Enterococcus faecalis strain L6D |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | QUD71_RS05775 | Protein ID | WP_015543884.1 |
Coordinates | 1180696..1180791 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 1180597..1180661 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QUD71_RS05760 | 1176222..1177970 | + | 1749 | WP_010819726.1 | PTS transporter subunit EIIC | - |
QUD71_RS05765 | 1177961..1179994 | + | 2034 | WP_010819727.1 | BglG family transcription antiterminator | - |
QUD71_RS05770 | 1180005..1180439 | + | 435 | WP_010711967.1 | PTS sugar transporter subunit IIA | - |
- | 1180597..1180661 | + | 65 | - | - | Antitoxin |
QUD71_RS05775 | 1180696..1180791 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
QUD71_RS05780 | 1181037..1182809 | + | 1773 | WP_010819728.1 | PTS mannitol-specific transporter subunit IIBC | - |
QUD71_RS05785 | 1182824..1183261 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
QUD71_RS05790 | 1183276..1184430 | + | 1155 | WP_010819729.1 | mannitol-1-phosphate 5-dehydrogenase | - |
QUD71_RS05795 | 1184498..1185613 | - | 1116 | WP_081115739.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T43717 WP_015543884.1 NZ_AP027297:c1180791-1180696 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T43717 NZ_AP027297:c1180791-1180696 [Enterococcus faecalis]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGCTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGCTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 65 bp
>AT43717 NZ_AP027297:1180597-1180661 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGCAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|