Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1346038..1346258 Replicon chromosome
Accession NZ_AP027258
Organism Escherichia coli strain JNE151685

Toxin (Protein)


Gene name ldrD Uniprot ID A0A2Y8S137
Locus tag QUE29_RS06670 Protein ID WP_000170957.1
Coordinates 1346038..1346145 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1346195..1346258 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QUE29_RS06645 (1341882) 1341882..1342964 + 1083 WP_000804726.1 peptide chain release factor 1 -
QUE29_RS06650 (1342964) 1342964..1343797 + 834 WP_182533222.1 peptide chain release factor N(5)-glutamine methyltransferase -
QUE29_RS06655 (1343794) 1343794..1344186 + 393 WP_000200374.1 invasion regulator SirB2 -
QUE29_RS06660 (1344190) 1344190..1344999 + 810 WP_001257044.1 invasion regulator SirB1 -
QUE29_RS06665 (1345035) 1345035..1345889 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QUE29_RS06670 (1346038) 1346038..1346145 - 108 WP_000170957.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1346195) 1346195..1346258 + 64 NuclAT_38 - Antitoxin
- (1346195) 1346195..1346258 + 64 NuclAT_38 - Antitoxin
- (1346195) 1346195..1346258 + 64 NuclAT_38 - Antitoxin
- (1346195) 1346195..1346258 + 64 NuclAT_38 - Antitoxin
- (1346195) 1346195..1346258 + 64 NuclAT_40 - Antitoxin
- (1346195) 1346195..1346258 + 64 NuclAT_40 - Antitoxin
- (1346195) 1346195..1346258 + 64 NuclAT_40 - Antitoxin
- (1346195) 1346195..1346258 + 64 NuclAT_40 - Antitoxin
- (1346195) 1346195..1346258 + 64 NuclAT_42 - Antitoxin
- (1346195) 1346195..1346258 + 64 NuclAT_42 - Antitoxin
- (1346195) 1346195..1346258 + 64 NuclAT_42 - Antitoxin
- (1346195) 1346195..1346258 + 64 NuclAT_42 - Antitoxin
QUE29_RS06675 (1346573) 1346573..1346680 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1346728) 1346728..1346793 + 66 NuclAT_37 - -
- (1346728) 1346728..1346793 + 66 NuclAT_37 - -
- (1346728) 1346728..1346793 + 66 NuclAT_37 - -
- (1346728) 1346728..1346793 + 66 NuclAT_37 - -
- (1346728) 1346728..1346793 + 66 NuclAT_39 - -
- (1346728) 1346728..1346793 + 66 NuclAT_39 - -
- (1346728) 1346728..1346793 + 66 NuclAT_39 - -
- (1346728) 1346728..1346793 + 66 NuclAT_39 - -
- (1346728) 1346728..1346793 + 66 NuclAT_41 - -
- (1346728) 1346728..1346793 + 66 NuclAT_41 - -
- (1346728) 1346728..1346793 + 66 NuclAT_41 - -
- (1346728) 1346728..1346793 + 66 NuclAT_41 - -
- (1346728) 1346728..1346795 + 68 NuclAT_13 - -
- (1346728) 1346728..1346795 + 68 NuclAT_13 - -
- (1346728) 1346728..1346795 + 68 NuclAT_13 - -
- (1346728) 1346728..1346795 + 68 NuclAT_13 - -
- (1346728) 1346728..1346795 + 68 NuclAT_14 - -
- (1346728) 1346728..1346795 + 68 NuclAT_14 - -
- (1346728) 1346728..1346795 + 68 NuclAT_14 - -
- (1346728) 1346728..1346795 + 68 NuclAT_14 - -
- (1346728) 1346728..1346795 + 68 NuclAT_15 - -
- (1346728) 1346728..1346795 + 68 NuclAT_15 - -
- (1346728) 1346728..1346795 + 68 NuclAT_15 - -
- (1346728) 1346728..1346795 + 68 NuclAT_15 - -
- (1346728) 1346728..1346795 + 68 NuclAT_16 - -
- (1346728) 1346728..1346795 + 68 NuclAT_16 - -
- (1346728) 1346728..1346795 + 68 NuclAT_16 - -
- (1346728) 1346728..1346795 + 68 NuclAT_16 - -
- (1346728) 1346728..1346795 + 68 NuclAT_17 - -
- (1346728) 1346728..1346795 + 68 NuclAT_17 - -
- (1346728) 1346728..1346795 + 68 NuclAT_17 - -
- (1346728) 1346728..1346795 + 68 NuclAT_17 - -
- (1346728) 1346728..1346795 + 68 NuclAT_18 - -
- (1346728) 1346728..1346795 + 68 NuclAT_18 - -
- (1346728) 1346728..1346795 + 68 NuclAT_18 - -
- (1346728) 1346728..1346795 + 68 NuclAT_18 - -
QUE29_RS06680 (1347085) 1347085..1348185 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
QUE29_RS06685 (1348455) 1348455..1348685 + 231 WP_001146442.1 putative cation transport regulator ChaB -
QUE29_RS06690 (1348843) 1348843..1349538 + 696 WP_001355927.1 glutathione-specific gamma-glutamylcyclotransferase -
QUE29_RS06695 (1349582) 1349582..1349935 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T43639 WP_000170957.1 NZ_AP027258:c1346145-1346038 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGITTAAIVGWWRNRK

Download         Length: 108 bp

>T43639 NZ_AP027258:c1346145-1346038 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTACTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT43639 NZ_AP027258:1346195-1346258 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Y8S137

Antitoxin

Download structure file

References