Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 3942067..3942289 | Replicon | chromosome |
Accession | NZ_AP027254 | ||
Organism | Escherichia coli strain JNE120442 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | QUE31_RS19635 | Protein ID | WP_001295224.1 |
Coordinates | 3942067..3942174 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 3942223..3942289 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QUE31_RS19610 | 3937320..3938072 | - | 753 | WP_000279544.1 | cellulose biosynthesis protein BcsQ | - |
QUE31_RS19615 | 3938084..3938272 | - | 189 | WP_001063315.1 | cellulose biosynthesis protein BcsR | - |
QUE31_RS19620 | 3938545..3940116 | + | 1572 | WP_001204944.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
QUE31_RS19625 | 3940113..3940304 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
QUE31_RS19630 | 3940301..3941980 | + | 1680 | WP_001562264.1 | cellulose biosynthesis protein BcsG | - |
QUE31_RS19635 | 3942067..3942174 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 3942223..3942289 | + | 67 | - | - | Antitoxin |
QUE31_RS19640 | 3942650..3943921 | + | 1272 | WP_001318103.1 | aromatic amino acid transport family protein | - |
QUE31_RS19645 | 3943951..3944955 | - | 1005 | WP_000107036.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
QUE31_RS19650 | 3944952..3945935 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
QUE31_RS19655 | 3945946..3946848 | - | 903 | WP_016238586.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T43605 WP_001295224.1 NZ_AP027254:c3942174-3942067 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T43605 NZ_AP027254:c3942174-3942067 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT43605 NZ_AP027254:3942223-3942289 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|