Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1392674..1392895 Replicon chromosome
Accession NZ_AP027217
Organism Escherichia coli strain JNE170426

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag QUE10_RS06665 Protein ID WP_000170954.1
Coordinates 1392674..1392781 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1392829..1392895 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QUE10_RS06640 (1388518) 1388518..1389600 + 1083 WP_000804726.1 peptide chain release factor 1 -
QUE10_RS06645 (1389600) 1389600..1390433 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
QUE10_RS06650 (1390430) 1390430..1390822 + 393 WP_000200378.1 invasion regulator SirB2 -
QUE10_RS06655 (1390826) 1390826..1391635 + 810 WP_001257044.1 invasion regulator SirB1 -
QUE10_RS06660 (1391671) 1391671..1392525 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QUE10_RS06665 (1392674) 1392674..1392781 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1392831) 1392831..1392894 + 64 NuclAT_40 - -
- (1392831) 1392831..1392894 + 64 NuclAT_40 - -
- (1392831) 1392831..1392894 + 64 NuclAT_40 - -
- (1392831) 1392831..1392894 + 64 NuclAT_40 - -
- (1392831) 1392831..1392894 + 64 NuclAT_42 - -
- (1392831) 1392831..1392894 + 64 NuclAT_42 - -
- (1392831) 1392831..1392894 + 64 NuclAT_42 - -
- (1392831) 1392831..1392894 + 64 NuclAT_42 - -
- (1392831) 1392831..1392894 + 64 NuclAT_44 - -
- (1392831) 1392831..1392894 + 64 NuclAT_44 - -
- (1392831) 1392831..1392894 + 64 NuclAT_44 - -
- (1392831) 1392831..1392894 + 64 NuclAT_44 - -
- (1392829) 1392829..1392895 + 67 NuclAT_27 - Antitoxin
- (1392829) 1392829..1392895 + 67 NuclAT_27 - Antitoxin
- (1392829) 1392829..1392895 + 67 NuclAT_27 - Antitoxin
- (1392829) 1392829..1392895 + 67 NuclAT_27 - Antitoxin
- (1392829) 1392829..1392895 + 67 NuclAT_29 - Antitoxin
- (1392829) 1392829..1392895 + 67 NuclAT_29 - Antitoxin
- (1392829) 1392829..1392895 + 67 NuclAT_29 - Antitoxin
- (1392829) 1392829..1392895 + 67 NuclAT_29 - Antitoxin
- (1392829) 1392829..1392895 + 67 NuclAT_31 - Antitoxin
- (1392829) 1392829..1392895 + 67 NuclAT_31 - Antitoxin
- (1392829) 1392829..1392895 + 67 NuclAT_31 - Antitoxin
- (1392829) 1392829..1392895 + 67 NuclAT_31 - Antitoxin
- (1392829) 1392829..1392895 + 67 NuclAT_33 - Antitoxin
- (1392829) 1392829..1392895 + 67 NuclAT_33 - Antitoxin
- (1392829) 1392829..1392895 + 67 NuclAT_33 - Antitoxin
- (1392829) 1392829..1392895 + 67 NuclAT_33 - Antitoxin
- (1392829) 1392829..1392895 + 67 NuclAT_35 - Antitoxin
- (1392829) 1392829..1392895 + 67 NuclAT_35 - Antitoxin
- (1392829) 1392829..1392895 + 67 NuclAT_35 - Antitoxin
- (1392829) 1392829..1392895 + 67 NuclAT_35 - Antitoxin
- (1392829) 1392829..1392895 + 67 NuclAT_37 - Antitoxin
- (1392829) 1392829..1392895 + 67 NuclAT_37 - Antitoxin
- (1392829) 1392829..1392895 + 67 NuclAT_37 - Antitoxin
- (1392829) 1392829..1392895 + 67 NuclAT_37 - Antitoxin
QUE10_RS06670 (1393209) 1393209..1393316 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1393369) 1393369..1393430 + 62 NuclAT_39 - -
- (1393369) 1393369..1393430 + 62 NuclAT_39 - -
- (1393369) 1393369..1393430 + 62 NuclAT_39 - -
- (1393369) 1393369..1393430 + 62 NuclAT_39 - -
- (1393369) 1393369..1393430 + 62 NuclAT_41 - -
- (1393369) 1393369..1393430 + 62 NuclAT_41 - -
- (1393369) 1393369..1393430 + 62 NuclAT_41 - -
- (1393369) 1393369..1393430 + 62 NuclAT_41 - -
- (1393369) 1393369..1393430 + 62 NuclAT_43 - -
- (1393369) 1393369..1393430 + 62 NuclAT_43 - -
- (1393369) 1393369..1393430 + 62 NuclAT_43 - -
- (1393369) 1393369..1393430 + 62 NuclAT_43 - -
- (1393369) 1393369..1393431 + 63 NuclAT_28 - -
- (1393369) 1393369..1393431 + 63 NuclAT_28 - -
- (1393369) 1393369..1393431 + 63 NuclAT_28 - -
- (1393369) 1393369..1393431 + 63 NuclAT_28 - -
- (1393369) 1393369..1393431 + 63 NuclAT_30 - -
- (1393369) 1393369..1393431 + 63 NuclAT_30 - -
- (1393369) 1393369..1393431 + 63 NuclAT_30 - -
- (1393369) 1393369..1393431 + 63 NuclAT_30 - -
- (1393369) 1393369..1393431 + 63 NuclAT_32 - -
- (1393369) 1393369..1393431 + 63 NuclAT_32 - -
- (1393369) 1393369..1393431 + 63 NuclAT_32 - -
- (1393369) 1393369..1393431 + 63 NuclAT_32 - -
- (1393369) 1393369..1393431 + 63 NuclAT_34 - -
- (1393369) 1393369..1393431 + 63 NuclAT_34 - -
- (1393369) 1393369..1393431 + 63 NuclAT_34 - -
- (1393369) 1393369..1393431 + 63 NuclAT_34 - -
- (1393369) 1393369..1393431 + 63 NuclAT_36 - -
- (1393369) 1393369..1393431 + 63 NuclAT_36 - -
- (1393369) 1393369..1393431 + 63 NuclAT_36 - -
- (1393369) 1393369..1393431 + 63 NuclAT_36 - -
- (1393369) 1393369..1393431 + 63 NuclAT_38 - -
- (1393369) 1393369..1393431 + 63 NuclAT_38 - -
- (1393369) 1393369..1393431 + 63 NuclAT_38 - -
- (1393369) 1393369..1393431 + 63 NuclAT_38 - -
- (1393369) 1393369..1393432 + 64 NuclAT_16 - -
- (1393369) 1393369..1393432 + 64 NuclAT_16 - -
- (1393369) 1393369..1393432 + 64 NuclAT_16 - -
- (1393369) 1393369..1393432 + 64 NuclAT_16 - -
- (1393369) 1393369..1393432 + 64 NuclAT_18 - -
- (1393369) 1393369..1393432 + 64 NuclAT_18 - -
- (1393369) 1393369..1393432 + 64 NuclAT_18 - -
- (1393369) 1393369..1393432 + 64 NuclAT_18 - -
- (1393369) 1393369..1393432 + 64 NuclAT_20 - -
- (1393369) 1393369..1393432 + 64 NuclAT_20 - -
- (1393369) 1393369..1393432 + 64 NuclAT_20 - -
- (1393369) 1393369..1393432 + 64 NuclAT_20 - -
- (1393369) 1393369..1393432 + 64 NuclAT_22 - -
- (1393369) 1393369..1393432 + 64 NuclAT_22 - -
- (1393369) 1393369..1393432 + 64 NuclAT_22 - -
- (1393369) 1393369..1393432 + 64 NuclAT_22 - -
- (1393369) 1393369..1393432 + 64 NuclAT_24 - -
- (1393369) 1393369..1393432 + 64 NuclAT_24 - -
- (1393369) 1393369..1393432 + 64 NuclAT_24 - -
- (1393369) 1393369..1393432 + 64 NuclAT_24 - -
- (1393369) 1393369..1393432 + 64 NuclAT_26 - -
- (1393369) 1393369..1393432 + 64 NuclAT_26 - -
- (1393369) 1393369..1393432 + 64 NuclAT_26 - -
- (1393369) 1393369..1393432 + 64 NuclAT_26 - -
QUE10_RS06675 (1393745) 1393745..1393852 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1393900) 1393900..1393967 + 68 NuclAT_15 - -
- (1393900) 1393900..1393967 + 68 NuclAT_15 - -
- (1393900) 1393900..1393967 + 68 NuclAT_15 - -
- (1393900) 1393900..1393967 + 68 NuclAT_15 - -
- (1393900) 1393900..1393967 + 68 NuclAT_17 - -
- (1393900) 1393900..1393967 + 68 NuclAT_17 - -
- (1393900) 1393900..1393967 + 68 NuclAT_17 - -
- (1393900) 1393900..1393967 + 68 NuclAT_17 - -
- (1393900) 1393900..1393967 + 68 NuclAT_19 - -
- (1393900) 1393900..1393967 + 68 NuclAT_19 - -
- (1393900) 1393900..1393967 + 68 NuclAT_19 - -
- (1393900) 1393900..1393967 + 68 NuclAT_19 - -
- (1393900) 1393900..1393967 + 68 NuclAT_21 - -
- (1393900) 1393900..1393967 + 68 NuclAT_21 - -
- (1393900) 1393900..1393967 + 68 NuclAT_21 - -
- (1393900) 1393900..1393967 + 68 NuclAT_21 - -
- (1393900) 1393900..1393967 + 68 NuclAT_23 - -
- (1393900) 1393900..1393967 + 68 NuclAT_23 - -
- (1393900) 1393900..1393967 + 68 NuclAT_23 - -
- (1393900) 1393900..1393967 + 68 NuclAT_23 - -
- (1393900) 1393900..1393967 + 68 NuclAT_25 - -
- (1393900) 1393900..1393967 + 68 NuclAT_25 - -
- (1393900) 1393900..1393967 + 68 NuclAT_25 - -
- (1393900) 1393900..1393967 + 68 NuclAT_25 - -
QUE10_RS06680 (1394257) 1394257..1395357 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
QUE10_RS06685 (1395627) 1395627..1395857 + 231 WP_001146442.1 putative cation transport regulator ChaB -
QUE10_RS06690 (1396015) 1396015..1396710 + 696 WP_001355927.1 glutathione-specific gamma-glutamylcyclotransferase -
QUE10_RS06695 (1396754) 1396754..1397107 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T43534 WP_000170954.1 NZ_AP027217:c1392781-1392674 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T43534 NZ_AP027217:c1392781-1392674 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT43534 NZ_AP027217:1392829-1392895 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References