Detailed information of TA system TA043432

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 19643..19912
• Replicon: plasmid pO26_10153_3
• Accession: NZ_AP027194
• Organism: Escherichia coli strain 10153

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QMG89_RS31285
• Protein ID: WP_001372321.1
• Coordinates: 19787..19912 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	19643..19708 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QMG89_RS31245 (14688)	14688..14936	+	249	WP_072131852.1	hypothetical protein	-
QMG89_RS31250 (15408)	15408..15956	+	549	WP_000290809.1	single-stranded DNA-binding protein	-
QMG89_RS31255 (16014)	16014..16247	+	234	WP_000006011.1	DUF905 family protein	-
QMG89_RS31260 (16311)	16311..18269	+	1959	WP_100039124.1	ParB/RepB/Spo0J family partition protein	-
QMG89_RS31265 (18324)	18324..18758	+	435	WP_032217500.1	conjugation system SOS inhibitor PsiB	-
QMG89_RS31270 (18755)	18755..19517	+	763	Protein_28	plasmid SOS inhibition protein A	-
QMG89_RS31275 (19486)	19486..19674	-	189	WP_001299721.1	hypothetical protein	-
- (19642)	19642..19705	-	64	NuclAT_1	-	-
- (19642)	19642..19705	-	64	NuclAT_1	-	-
- (19643)	19643..19708	+	66	NuclAT_0	-	Antitoxin
- (19643)	19643..19708	+	66	NuclAT_0	-	Antitoxin
- (19643)	19643..19708	+	66	NuclAT_1	-	Antitoxin
- (19486)	19486..19710	+	225	NuclAT_0	-	-
- (19486)	19486..19710	+	225	NuclAT_0	-	-
- (19486)	19486..19710	+	225	NuclAT_0	-	-
- (19486)	19486..19710	+	225	NuclAT_0	-	-
- (19486)	19486..19710	-	225	NuclAT_0	-	-
QMG89_RS31280 (19696)	19696..19845	+	150	Protein_30	plasmid maintenance protein Mok	-
QMG89_RS31285 (19787)	19787..19912	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QMG89_RS31290 (20132)	20132..20362	+	231	WP_001426396.1	hypothetical protein	-
QMG89_RS31295 (20360)	20360..20533	-	174	Protein_33	hypothetical protein	-
QMG89_RS31300 (20603)	20603..20809	+	207	WP_000547968.1	hypothetical protein	-
QMG89_RS31305 (20834)	20834..21121	+	288	WP_000107535.1	hypothetical protein	-
QMG89_RS31310 (21241)	21241..22062	+	822	WP_001234469.1	DUF932 domain-containing protein	-
QMG89_RS31315 (22359)	22359..23006	-	648	WP_141078732.1	transglycosylase SLT domain-containing protein	-
QMG89_RS31320 (23282)	23282..23665	+	384	WP_001151533.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QMG89_RS31325 (23857)	23857..24504	+	648	WP_034169362.1	transcriptional regulator TraJ family protein	-
QMG89_RS31330 (24624)	24624..24851	+	228	WP_000589558.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T43432 WP_001372321.1 NZ_AP027194:19787-19912 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T43432 NZ_AP027194:19787-19912 [Escherichia coli]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT43432 NZ_AP027194:19643-19708 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC

Structures

Antitoxin