Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1830255..1830475 Replicon chromosome
Accession NZ_AP027191
Organism Escherichia coli strain 10153

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag QMG89_RS09810 Protein ID WP_000170954.1
Coordinates 1830255..1830362 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1830412..1830475 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QMG89_RS09785 (1826099) 1826099..1827181 + 1083 WP_000804726.1 peptide chain release factor 1 -
QMG89_RS09790 (1827181) 1827181..1828014 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
QMG89_RS09795 (1828011) 1828011..1828403 + 393 WP_000200378.1 invasion regulator SirB2 -
QMG89_RS09800 (1828407) 1828407..1829216 + 810 WP_001257045.1 invasion regulator SirB1 -
QMG89_RS09805 (1829252) 1829252..1830106 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QMG89_RS09810 (1830255) 1830255..1830362 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1830412) 1830412..1830475 + 64 NuclAT_32 - Antitoxin
- (1830412) 1830412..1830475 + 64 NuclAT_32 - Antitoxin
- (1830412) 1830412..1830475 + 64 NuclAT_32 - Antitoxin
- (1830412) 1830412..1830475 + 64 NuclAT_32 - Antitoxin
- (1830412) 1830412..1830475 + 64 NuclAT_35 - Antitoxin
- (1830412) 1830412..1830475 + 64 NuclAT_35 - Antitoxin
- (1830412) 1830412..1830475 + 64 NuclAT_35 - Antitoxin
- (1830412) 1830412..1830475 + 64 NuclAT_35 - Antitoxin
- (1830412) 1830412..1830475 + 64 NuclAT_38 - Antitoxin
- (1830412) 1830412..1830475 + 64 NuclAT_38 - Antitoxin
- (1830412) 1830412..1830475 + 64 NuclAT_38 - Antitoxin
- (1830412) 1830412..1830475 + 64 NuclAT_38 - Antitoxin
- (1830412) 1830412..1830475 + 64 NuclAT_41 - Antitoxin
- (1830412) 1830412..1830475 + 64 NuclAT_41 - Antitoxin
- (1830412) 1830412..1830475 + 64 NuclAT_41 - Antitoxin
- (1830412) 1830412..1830475 + 64 NuclAT_41 - Antitoxin
- (1830412) 1830412..1830475 + 64 NuclAT_44 - Antitoxin
- (1830412) 1830412..1830475 + 64 NuclAT_44 - Antitoxin
- (1830412) 1830412..1830475 + 64 NuclAT_44 - Antitoxin
- (1830412) 1830412..1830475 + 64 NuclAT_44 - Antitoxin
- (1830412) 1830412..1830475 + 64 NuclAT_47 - Antitoxin
- (1830412) 1830412..1830475 + 64 NuclAT_47 - Antitoxin
- (1830412) 1830412..1830475 + 64 NuclAT_47 - Antitoxin
- (1830412) 1830412..1830475 + 64 NuclAT_47 - Antitoxin
QMG89_RS09815 (1830790) 1830790..1830897 - 108 WP_000170959.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1830950) 1830950..1831011 + 62 NuclAT_31 - -
- (1830950) 1830950..1831011 + 62 NuclAT_31 - -
- (1830950) 1830950..1831011 + 62 NuclAT_31 - -
- (1830950) 1830950..1831011 + 62 NuclAT_31 - -
- (1830950) 1830950..1831011 + 62 NuclAT_34 - -
- (1830950) 1830950..1831011 + 62 NuclAT_34 - -
- (1830950) 1830950..1831011 + 62 NuclAT_34 - -
- (1830950) 1830950..1831011 + 62 NuclAT_34 - -
- (1830950) 1830950..1831011 + 62 NuclAT_37 - -
- (1830950) 1830950..1831011 + 62 NuclAT_37 - -
- (1830950) 1830950..1831011 + 62 NuclAT_37 - -
- (1830950) 1830950..1831011 + 62 NuclAT_37 - -
- (1830950) 1830950..1831011 + 62 NuclAT_40 - -
- (1830950) 1830950..1831011 + 62 NuclAT_40 - -
- (1830950) 1830950..1831011 + 62 NuclAT_40 - -
- (1830950) 1830950..1831011 + 62 NuclAT_40 - -
- (1830950) 1830950..1831011 + 62 NuclAT_43 - -
- (1830950) 1830950..1831011 + 62 NuclAT_43 - -
- (1830950) 1830950..1831011 + 62 NuclAT_43 - -
- (1830950) 1830950..1831011 + 62 NuclAT_43 - -
- (1830950) 1830950..1831011 + 62 NuclAT_46 - -
- (1830950) 1830950..1831011 + 62 NuclAT_46 - -
- (1830950) 1830950..1831011 + 62 NuclAT_46 - -
- (1830950) 1830950..1831011 + 62 NuclAT_46 - -
- (1830950) 1830950..1831013 + 64 NuclAT_17 - -
- (1830950) 1830950..1831013 + 64 NuclAT_17 - -
- (1830950) 1830950..1831013 + 64 NuclAT_17 - -
- (1830950) 1830950..1831013 + 64 NuclAT_17 - -
- (1830950) 1830950..1831013 + 64 NuclAT_19 - -
- (1830950) 1830950..1831013 + 64 NuclAT_19 - -
- (1830950) 1830950..1831013 + 64 NuclAT_19 - -
- (1830950) 1830950..1831013 + 64 NuclAT_19 - -
- (1830950) 1830950..1831013 + 64 NuclAT_21 - -
- (1830950) 1830950..1831013 + 64 NuclAT_21 - -
- (1830950) 1830950..1831013 + 64 NuclAT_21 - -
- (1830950) 1830950..1831013 + 64 NuclAT_21 - -
- (1830950) 1830950..1831013 + 64 NuclAT_23 - -
- (1830950) 1830950..1831013 + 64 NuclAT_23 - -
- (1830950) 1830950..1831013 + 64 NuclAT_23 - -
- (1830950) 1830950..1831013 + 64 NuclAT_23 - -
- (1830950) 1830950..1831013 + 64 NuclAT_25 - -
- (1830950) 1830950..1831013 + 64 NuclAT_25 - -
- (1830950) 1830950..1831013 + 64 NuclAT_25 - -
- (1830950) 1830950..1831013 + 64 NuclAT_25 - -
- (1830950) 1830950..1831013 + 64 NuclAT_27 - -
- (1830950) 1830950..1831013 + 64 NuclAT_27 - -
- (1830950) 1830950..1831013 + 64 NuclAT_27 - -
- (1830950) 1830950..1831013 + 64 NuclAT_27 - -
QMG89_RS09820 (1831326) 1831326..1831433 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1831481) 1831481..1831546 + 66 NuclAT_30 - -
- (1831481) 1831481..1831546 + 66 NuclAT_30 - -
- (1831481) 1831481..1831546 + 66 NuclAT_30 - -
- (1831481) 1831481..1831546 + 66 NuclAT_30 - -
- (1831481) 1831481..1831546 + 66 NuclAT_33 - -
- (1831481) 1831481..1831546 + 66 NuclAT_33 - -
- (1831481) 1831481..1831546 + 66 NuclAT_33 - -
- (1831481) 1831481..1831546 + 66 NuclAT_33 - -
- (1831481) 1831481..1831546 + 66 NuclAT_36 - -
- (1831481) 1831481..1831546 + 66 NuclAT_36 - -
- (1831481) 1831481..1831546 + 66 NuclAT_36 - -
- (1831481) 1831481..1831546 + 66 NuclAT_36 - -
- (1831481) 1831481..1831546 + 66 NuclAT_39 - -
- (1831481) 1831481..1831546 + 66 NuclAT_39 - -
- (1831481) 1831481..1831546 + 66 NuclAT_39 - -
- (1831481) 1831481..1831546 + 66 NuclAT_39 - -
- (1831481) 1831481..1831546 + 66 NuclAT_42 - -
- (1831481) 1831481..1831546 + 66 NuclAT_42 - -
- (1831481) 1831481..1831546 + 66 NuclAT_42 - -
- (1831481) 1831481..1831546 + 66 NuclAT_42 - -
- (1831481) 1831481..1831546 + 66 NuclAT_45 - -
- (1831481) 1831481..1831546 + 66 NuclAT_45 - -
- (1831481) 1831481..1831546 + 66 NuclAT_45 - -
- (1831481) 1831481..1831546 + 66 NuclAT_45 - -
- (1831481) 1831481..1831548 + 68 NuclAT_16 - -
- (1831481) 1831481..1831548 + 68 NuclAT_16 - -
- (1831481) 1831481..1831548 + 68 NuclAT_16 - -
- (1831481) 1831481..1831548 + 68 NuclAT_16 - -
- (1831481) 1831481..1831548 + 68 NuclAT_18 - -
- (1831481) 1831481..1831548 + 68 NuclAT_18 - -
- (1831481) 1831481..1831548 + 68 NuclAT_18 - -
- (1831481) 1831481..1831548 + 68 NuclAT_18 - -
- (1831481) 1831481..1831548 + 68 NuclAT_20 - -
- (1831481) 1831481..1831548 + 68 NuclAT_20 - -
- (1831481) 1831481..1831548 + 68 NuclAT_20 - -
- (1831481) 1831481..1831548 + 68 NuclAT_20 - -
- (1831481) 1831481..1831548 + 68 NuclAT_22 - -
- (1831481) 1831481..1831548 + 68 NuclAT_22 - -
- (1831481) 1831481..1831548 + 68 NuclAT_22 - -
- (1831481) 1831481..1831548 + 68 NuclAT_22 - -
- (1831481) 1831481..1831548 + 68 NuclAT_24 - -
- (1831481) 1831481..1831548 + 68 NuclAT_24 - -
- (1831481) 1831481..1831548 + 68 NuclAT_24 - -
- (1831481) 1831481..1831548 + 68 NuclAT_24 - -
- (1831481) 1831481..1831548 + 68 NuclAT_26 - -
- (1831481) 1831481..1831548 + 68 NuclAT_26 - -
- (1831481) 1831481..1831548 + 68 NuclAT_26 - -
- (1831481) 1831481..1831548 + 68 NuclAT_26 - -
QMG89_RS09825 (1831838) 1831838..1832938 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
QMG89_RS09830 (1833208) 1833208..1833438 + 231 WP_001146442.1 putative cation transport regulator ChaB -
QMG89_RS09835 (1833596) 1833596..1834291 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
QMG89_RS09840 (1834335) 1834335..1834688 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T43399 WP_000170954.1 NZ_AP027191:c1830362-1830255 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T43399 NZ_AP027191:c1830362-1830255 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT43399 NZ_AP027191:1830412-1830475 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References