Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1724522..1724742 Replicon chromosome
Accession NZ_AP027188
Organism Escherichia coli strain PV0838

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag QMG68_RS09080 Protein ID WP_000170954.1
Coordinates 1724522..1724629 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1724679..1724742 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QMG68_RS09055 (1720366) 1720366..1721448 + 1083 WP_000804726.1 peptide chain release factor 1 -
QMG68_RS09060 (1721448) 1721448..1722281 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
QMG68_RS09065 (1722278) 1722278..1722670 + 393 WP_000200378.1 invasion regulator SirB2 -
QMG68_RS09070 (1722674) 1722674..1723483 + 810 WP_001257045.1 invasion regulator SirB1 -
QMG68_RS09075 (1723519) 1723519..1724373 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QMG68_RS09080 (1724522) 1724522..1724629 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1724679) 1724679..1724742 + 64 NuclAT_31 - Antitoxin
- (1724679) 1724679..1724742 + 64 NuclAT_31 - Antitoxin
- (1724679) 1724679..1724742 + 64 NuclAT_31 - Antitoxin
- (1724679) 1724679..1724742 + 64 NuclAT_31 - Antitoxin
- (1724679) 1724679..1724742 + 64 NuclAT_34 - Antitoxin
- (1724679) 1724679..1724742 + 64 NuclAT_34 - Antitoxin
- (1724679) 1724679..1724742 + 64 NuclAT_34 - Antitoxin
- (1724679) 1724679..1724742 + 64 NuclAT_34 - Antitoxin
- (1724679) 1724679..1724742 + 64 NuclAT_37 - Antitoxin
- (1724679) 1724679..1724742 + 64 NuclAT_37 - Antitoxin
- (1724679) 1724679..1724742 + 64 NuclAT_37 - Antitoxin
- (1724679) 1724679..1724742 + 64 NuclAT_37 - Antitoxin
- (1724679) 1724679..1724742 + 64 NuclAT_40 - Antitoxin
- (1724679) 1724679..1724742 + 64 NuclAT_40 - Antitoxin
- (1724679) 1724679..1724742 + 64 NuclAT_40 - Antitoxin
- (1724679) 1724679..1724742 + 64 NuclAT_40 - Antitoxin
- (1724679) 1724679..1724742 + 64 NuclAT_43 - Antitoxin
- (1724679) 1724679..1724742 + 64 NuclAT_43 - Antitoxin
- (1724679) 1724679..1724742 + 64 NuclAT_43 - Antitoxin
- (1724679) 1724679..1724742 + 64 NuclAT_43 - Antitoxin
- (1724679) 1724679..1724742 + 64 NuclAT_46 - Antitoxin
- (1724679) 1724679..1724742 + 64 NuclAT_46 - Antitoxin
- (1724679) 1724679..1724742 + 64 NuclAT_46 - Antitoxin
- (1724679) 1724679..1724742 + 64 NuclAT_46 - Antitoxin
QMG68_RS09085 (1725057) 1725057..1725164 - 108 WP_000170959.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1725217) 1725217..1725278 + 62 NuclAT_30 - -
- (1725217) 1725217..1725278 + 62 NuclAT_30 - -
- (1725217) 1725217..1725278 + 62 NuclAT_30 - -
- (1725217) 1725217..1725278 + 62 NuclAT_30 - -
- (1725217) 1725217..1725278 + 62 NuclAT_33 - -
- (1725217) 1725217..1725278 + 62 NuclAT_33 - -
- (1725217) 1725217..1725278 + 62 NuclAT_33 - -
- (1725217) 1725217..1725278 + 62 NuclAT_33 - -
- (1725217) 1725217..1725278 + 62 NuclAT_36 - -
- (1725217) 1725217..1725278 + 62 NuclAT_36 - -
- (1725217) 1725217..1725278 + 62 NuclAT_36 - -
- (1725217) 1725217..1725278 + 62 NuclAT_36 - -
- (1725217) 1725217..1725278 + 62 NuclAT_39 - -
- (1725217) 1725217..1725278 + 62 NuclAT_39 - -
- (1725217) 1725217..1725278 + 62 NuclAT_39 - -
- (1725217) 1725217..1725278 + 62 NuclAT_39 - -
- (1725217) 1725217..1725278 + 62 NuclAT_42 - -
- (1725217) 1725217..1725278 + 62 NuclAT_42 - -
- (1725217) 1725217..1725278 + 62 NuclAT_42 - -
- (1725217) 1725217..1725278 + 62 NuclAT_42 - -
- (1725217) 1725217..1725278 + 62 NuclAT_45 - -
- (1725217) 1725217..1725278 + 62 NuclAT_45 - -
- (1725217) 1725217..1725278 + 62 NuclAT_45 - -
- (1725217) 1725217..1725278 + 62 NuclAT_45 - -
- (1725217) 1725217..1725280 + 64 NuclAT_16 - -
- (1725217) 1725217..1725280 + 64 NuclAT_16 - -
- (1725217) 1725217..1725280 + 64 NuclAT_16 - -
- (1725217) 1725217..1725280 + 64 NuclAT_16 - -
- (1725217) 1725217..1725280 + 64 NuclAT_18 - -
- (1725217) 1725217..1725280 + 64 NuclAT_18 - -
- (1725217) 1725217..1725280 + 64 NuclAT_18 - -
- (1725217) 1725217..1725280 + 64 NuclAT_18 - -
- (1725217) 1725217..1725280 + 64 NuclAT_20 - -
- (1725217) 1725217..1725280 + 64 NuclAT_20 - -
- (1725217) 1725217..1725280 + 64 NuclAT_20 - -
- (1725217) 1725217..1725280 + 64 NuclAT_20 - -
- (1725217) 1725217..1725280 + 64 NuclAT_22 - -
- (1725217) 1725217..1725280 + 64 NuclAT_22 - -
- (1725217) 1725217..1725280 + 64 NuclAT_22 - -
- (1725217) 1725217..1725280 + 64 NuclAT_22 - -
- (1725217) 1725217..1725280 + 64 NuclAT_24 - -
- (1725217) 1725217..1725280 + 64 NuclAT_24 - -
- (1725217) 1725217..1725280 + 64 NuclAT_24 - -
- (1725217) 1725217..1725280 + 64 NuclAT_24 - -
- (1725217) 1725217..1725280 + 64 NuclAT_26 - -
- (1725217) 1725217..1725280 + 64 NuclAT_26 - -
- (1725217) 1725217..1725280 + 64 NuclAT_26 - -
- (1725217) 1725217..1725280 + 64 NuclAT_26 - -
QMG68_RS09090 (1725593) 1725593..1725700 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1725748) 1725748..1725813 + 66 NuclAT_29 - -
- (1725748) 1725748..1725813 + 66 NuclAT_29 - -
- (1725748) 1725748..1725813 + 66 NuclAT_29 - -
- (1725748) 1725748..1725813 + 66 NuclAT_29 - -
- (1725748) 1725748..1725813 + 66 NuclAT_32 - -
- (1725748) 1725748..1725813 + 66 NuclAT_32 - -
- (1725748) 1725748..1725813 + 66 NuclAT_32 - -
- (1725748) 1725748..1725813 + 66 NuclAT_32 - -
- (1725748) 1725748..1725813 + 66 NuclAT_35 - -
- (1725748) 1725748..1725813 + 66 NuclAT_35 - -
- (1725748) 1725748..1725813 + 66 NuclAT_35 - -
- (1725748) 1725748..1725813 + 66 NuclAT_35 - -
- (1725748) 1725748..1725813 + 66 NuclAT_38 - -
- (1725748) 1725748..1725813 + 66 NuclAT_38 - -
- (1725748) 1725748..1725813 + 66 NuclAT_38 - -
- (1725748) 1725748..1725813 + 66 NuclAT_38 - -
- (1725748) 1725748..1725813 + 66 NuclAT_41 - -
- (1725748) 1725748..1725813 + 66 NuclAT_41 - -
- (1725748) 1725748..1725813 + 66 NuclAT_41 - -
- (1725748) 1725748..1725813 + 66 NuclAT_41 - -
- (1725748) 1725748..1725813 + 66 NuclAT_44 - -
- (1725748) 1725748..1725813 + 66 NuclAT_44 - -
- (1725748) 1725748..1725813 + 66 NuclAT_44 - -
- (1725748) 1725748..1725813 + 66 NuclAT_44 - -
- (1725748) 1725748..1725815 + 68 NuclAT_15 - -
- (1725748) 1725748..1725815 + 68 NuclAT_15 - -
- (1725748) 1725748..1725815 + 68 NuclAT_15 - -
- (1725748) 1725748..1725815 + 68 NuclAT_15 - -
- (1725748) 1725748..1725815 + 68 NuclAT_17 - -
- (1725748) 1725748..1725815 + 68 NuclAT_17 - -
- (1725748) 1725748..1725815 + 68 NuclAT_17 - -
- (1725748) 1725748..1725815 + 68 NuclAT_17 - -
- (1725748) 1725748..1725815 + 68 NuclAT_19 - -
- (1725748) 1725748..1725815 + 68 NuclAT_19 - -
- (1725748) 1725748..1725815 + 68 NuclAT_19 - -
- (1725748) 1725748..1725815 + 68 NuclAT_19 - -
- (1725748) 1725748..1725815 + 68 NuclAT_21 - -
- (1725748) 1725748..1725815 + 68 NuclAT_21 - -
- (1725748) 1725748..1725815 + 68 NuclAT_21 - -
- (1725748) 1725748..1725815 + 68 NuclAT_21 - -
- (1725748) 1725748..1725815 + 68 NuclAT_23 - -
- (1725748) 1725748..1725815 + 68 NuclAT_23 - -
- (1725748) 1725748..1725815 + 68 NuclAT_23 - -
- (1725748) 1725748..1725815 + 68 NuclAT_23 - -
- (1725748) 1725748..1725815 + 68 NuclAT_25 - -
- (1725748) 1725748..1725815 + 68 NuclAT_25 - -
- (1725748) 1725748..1725815 + 68 NuclAT_25 - -
- (1725748) 1725748..1725815 + 68 NuclAT_25 - -
QMG68_RS09095 (1726105) 1726105..1727205 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
QMG68_RS09100 (1727475) 1727475..1727705 + 231 WP_001146442.1 putative cation transport regulator ChaB -
QMG68_RS09105 (1727863) 1727863..1728558 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
QMG68_RS09110 (1728602) 1728602..1728955 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T43366 WP_000170954.1 NZ_AP027188:c1724629-1724522 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T43366 NZ_AP027188:c1724629-1724522 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT43366 NZ_AP027188:1724679-1724742 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References