Detailed information of TA system TA043358

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 25137..25406
• Replicon: plasmid pO26_NIID080884_1
• Accession: NZ_AP027186
• Organism: Escherichia coli strain NIID080884

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QMG74_RS29470
• Protein ID: WP_001372321.1
• Coordinates: 25281..25406 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	25137..25202 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QMG74_RS29425	20198..20431	+	234	WP_071588969.1	hypothetical protein	-
QMG74_RS29430	20672..20878	+	207	WP_073520019.1	single-stranded DNA-binding protein	-
QMG74_RS29435	20904..21443	+	540	WP_000290841.1	single-stranded DNA-binding protein	-
QMG74_RS29440	21506..21739	+	234	WP_087086828.1	DUF905 family protein	-
QMG74_RS29445	21805..23763	+	1959	WP_099357091.1	ParB/RepB/Spo0J family partition protein	-
QMG74_RS29450	23818..24252	+	435	WP_042634413.1	conjugation system SOS inhibitor PsiB	-
QMG74_RS29455	24249..25011	+	763	Protein_34	plasmid SOS inhibition protein A	-
QMG74_RS29460	24980..25168	-	189	WP_001299721.1	hypothetical protein	-
-	24980..25204	+	225	NuclAT_0	-	-
-	24980..25204	+	225	NuclAT_0	-	-
-	24980..25204	+	225	NuclAT_0	-	-
-	24980..25204	+	225	NuclAT_0	-	-
-	25137..25202	+	66	-	-	Antitoxin
QMG74_RS29465	25190..25339	+	150	Protein_36	plasmid maintenance protein Mok	-
QMG74_RS29470	25281..25406	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QMG74_RS29475	25853..26026	-	174	Protein_38	hypothetical protein	-
QMG74_RS29480	26096..26302	+	207	WP_000547968.1	hypothetical protein	-
QMG74_RS29485	26327..26614	+	288	WP_000107535.1	hypothetical protein	-
QMG74_RS29490	26732..27553	+	822	WP_073520018.1	DUF932 domain-containing protein	-
QMG74_RS29495	27850..28497	-	648	WP_000614935.1	transglycosylase SLT domain-containing protein	-
QMG74_RS29500	28774..29157	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QMG74_RS29505	29348..30034	+	687	WP_073520017.1	PAS domain-containing protein	-
QMG74_RS29510	30128..30355	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T43358 WP_001372321.1 NZ_AP027186:25281-25406 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T43358 NZ_AP027186:25281-25406 [Escherichia coli]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT43358 NZ_AP027186:25137-25202 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC

Structures

Antitoxin