Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 25137..25406 | Replicon | plasmid pO26_NIID080884_1 |
| Accession | NZ_AP027186 | ||
| Organism | Escherichia coli strain NIID080884 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QMG74_RS29470 | Protein ID | WP_001372321.1 |
| Coordinates | 25281..25406 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 25137..25202 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMG74_RS29425 | 20198..20431 | + | 234 | WP_071588969.1 | hypothetical protein | - |
| QMG74_RS29430 | 20672..20878 | + | 207 | WP_073520019.1 | single-stranded DNA-binding protein | - |
| QMG74_RS29435 | 20904..21443 | + | 540 | WP_000290841.1 | single-stranded DNA-binding protein | - |
| QMG74_RS29440 | 21506..21739 | + | 234 | WP_087086828.1 | DUF905 family protein | - |
| QMG74_RS29445 | 21805..23763 | + | 1959 | WP_099357091.1 | ParB/RepB/Spo0J family partition protein | - |
| QMG74_RS29450 | 23818..24252 | + | 435 | WP_042634413.1 | conjugation system SOS inhibitor PsiB | - |
| QMG74_RS29455 | 24249..25011 | + | 763 | Protein_34 | plasmid SOS inhibition protein A | - |
| QMG74_RS29460 | 24980..25168 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 24980..25204 | + | 225 | NuclAT_0 | - | - |
| - | 24980..25204 | + | 225 | NuclAT_0 | - | - |
| - | 24980..25204 | + | 225 | NuclAT_0 | - | - |
| - | 24980..25204 | + | 225 | NuclAT_0 | - | - |
| - | 25137..25202 | + | 66 | - | - | Antitoxin |
| QMG74_RS29465 | 25190..25339 | + | 150 | Protein_36 | plasmid maintenance protein Mok | - |
| QMG74_RS29470 | 25281..25406 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QMG74_RS29475 | 25853..26026 | - | 174 | Protein_38 | hypothetical protein | - |
| QMG74_RS29480 | 26096..26302 | + | 207 | WP_000547968.1 | hypothetical protein | - |
| QMG74_RS29485 | 26327..26614 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| QMG74_RS29490 | 26732..27553 | + | 822 | WP_073520018.1 | DUF932 domain-containing protein | - |
| QMG74_RS29495 | 27850..28497 | - | 648 | WP_000614935.1 | transglycosylase SLT domain-containing protein | - |
| QMG74_RS29500 | 28774..29157 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QMG74_RS29505 | 29348..30034 | + | 687 | WP_073520017.1 | PAS domain-containing protein | - |
| QMG74_RS29510 | 30128..30355 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T43358 WP_001372321.1 NZ_AP027186:25281-25406 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T43358 NZ_AP027186:25281-25406 [Escherichia coli]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT43358 NZ_AP027186:25137-25202 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|