Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1762414..1762634 Replicon chromosome
Accession NZ_AP027185
Organism Escherichia coli strain NIID080884

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag QMG74_RS09165 Protein ID WP_000170954.1
Coordinates 1762414..1762521 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1762571..1762634 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QMG74_RS09140 (1758258) 1758258..1759340 + 1083 WP_000804726.1 peptide chain release factor 1 -
QMG74_RS09145 (1759340) 1759340..1760173 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
QMG74_RS09150 (1760170) 1760170..1760562 + 393 WP_000200378.1 invasion regulator SirB2 -
QMG74_RS09155 (1760566) 1760566..1761375 + 810 WP_001257045.1 invasion regulator SirB1 -
QMG74_RS09160 (1761411) 1761411..1762265 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QMG74_RS09165 (1762414) 1762414..1762521 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1762571) 1762571..1762634 + 64 NuclAT_31 - Antitoxin
- (1762571) 1762571..1762634 + 64 NuclAT_31 - Antitoxin
- (1762571) 1762571..1762634 + 64 NuclAT_31 - Antitoxin
- (1762571) 1762571..1762634 + 64 NuclAT_31 - Antitoxin
- (1762571) 1762571..1762634 + 64 NuclAT_34 - Antitoxin
- (1762571) 1762571..1762634 + 64 NuclAT_34 - Antitoxin
- (1762571) 1762571..1762634 + 64 NuclAT_34 - Antitoxin
- (1762571) 1762571..1762634 + 64 NuclAT_34 - Antitoxin
- (1762571) 1762571..1762634 + 64 NuclAT_37 - Antitoxin
- (1762571) 1762571..1762634 + 64 NuclAT_37 - Antitoxin
- (1762571) 1762571..1762634 + 64 NuclAT_37 - Antitoxin
- (1762571) 1762571..1762634 + 64 NuclAT_37 - Antitoxin
- (1762571) 1762571..1762634 + 64 NuclAT_40 - Antitoxin
- (1762571) 1762571..1762634 + 64 NuclAT_40 - Antitoxin
- (1762571) 1762571..1762634 + 64 NuclAT_40 - Antitoxin
- (1762571) 1762571..1762634 + 64 NuclAT_40 - Antitoxin
- (1762571) 1762571..1762634 + 64 NuclAT_43 - Antitoxin
- (1762571) 1762571..1762634 + 64 NuclAT_43 - Antitoxin
- (1762571) 1762571..1762634 + 64 NuclAT_43 - Antitoxin
- (1762571) 1762571..1762634 + 64 NuclAT_43 - Antitoxin
- (1762571) 1762571..1762634 + 64 NuclAT_46 - Antitoxin
- (1762571) 1762571..1762634 + 64 NuclAT_46 - Antitoxin
- (1762571) 1762571..1762634 + 64 NuclAT_46 - Antitoxin
- (1762571) 1762571..1762634 + 64 NuclAT_46 - Antitoxin
QMG74_RS09170 (1762949) 1762949..1763056 - 108 WP_000170959.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1763109) 1763109..1763170 + 62 NuclAT_30 - -
- (1763109) 1763109..1763170 + 62 NuclAT_30 - -
- (1763109) 1763109..1763170 + 62 NuclAT_30 - -
- (1763109) 1763109..1763170 + 62 NuclAT_30 - -
- (1763109) 1763109..1763170 + 62 NuclAT_33 - -
- (1763109) 1763109..1763170 + 62 NuclAT_33 - -
- (1763109) 1763109..1763170 + 62 NuclAT_33 - -
- (1763109) 1763109..1763170 + 62 NuclAT_33 - -
- (1763109) 1763109..1763170 + 62 NuclAT_36 - -
- (1763109) 1763109..1763170 + 62 NuclAT_36 - -
- (1763109) 1763109..1763170 + 62 NuclAT_36 - -
- (1763109) 1763109..1763170 + 62 NuclAT_36 - -
- (1763109) 1763109..1763170 + 62 NuclAT_39 - -
- (1763109) 1763109..1763170 + 62 NuclAT_39 - -
- (1763109) 1763109..1763170 + 62 NuclAT_39 - -
- (1763109) 1763109..1763170 + 62 NuclAT_39 - -
- (1763109) 1763109..1763170 + 62 NuclAT_42 - -
- (1763109) 1763109..1763170 + 62 NuclAT_42 - -
- (1763109) 1763109..1763170 + 62 NuclAT_42 - -
- (1763109) 1763109..1763170 + 62 NuclAT_42 - -
- (1763109) 1763109..1763170 + 62 NuclAT_45 - -
- (1763109) 1763109..1763170 + 62 NuclAT_45 - -
- (1763109) 1763109..1763170 + 62 NuclAT_45 - -
- (1763109) 1763109..1763170 + 62 NuclAT_45 - -
- (1763109) 1763109..1763172 + 64 NuclAT_16 - -
- (1763109) 1763109..1763172 + 64 NuclAT_16 - -
- (1763109) 1763109..1763172 + 64 NuclAT_16 - -
- (1763109) 1763109..1763172 + 64 NuclAT_16 - -
- (1763109) 1763109..1763172 + 64 NuclAT_18 - -
- (1763109) 1763109..1763172 + 64 NuclAT_18 - -
- (1763109) 1763109..1763172 + 64 NuclAT_18 - -
- (1763109) 1763109..1763172 + 64 NuclAT_18 - -
- (1763109) 1763109..1763172 + 64 NuclAT_20 - -
- (1763109) 1763109..1763172 + 64 NuclAT_20 - -
- (1763109) 1763109..1763172 + 64 NuclAT_20 - -
- (1763109) 1763109..1763172 + 64 NuclAT_20 - -
- (1763109) 1763109..1763172 + 64 NuclAT_22 - -
- (1763109) 1763109..1763172 + 64 NuclAT_22 - -
- (1763109) 1763109..1763172 + 64 NuclAT_22 - -
- (1763109) 1763109..1763172 + 64 NuclAT_22 - -
- (1763109) 1763109..1763172 + 64 NuclAT_24 - -
- (1763109) 1763109..1763172 + 64 NuclAT_24 - -
- (1763109) 1763109..1763172 + 64 NuclAT_24 - -
- (1763109) 1763109..1763172 + 64 NuclAT_24 - -
- (1763109) 1763109..1763172 + 64 NuclAT_26 - -
- (1763109) 1763109..1763172 + 64 NuclAT_26 - -
- (1763109) 1763109..1763172 + 64 NuclAT_26 - -
- (1763109) 1763109..1763172 + 64 NuclAT_26 - -
QMG74_RS09175 (1763485) 1763485..1763592 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1763640) 1763640..1763705 + 66 NuclAT_29 - -
- (1763640) 1763640..1763705 + 66 NuclAT_29 - -
- (1763640) 1763640..1763705 + 66 NuclAT_29 - -
- (1763640) 1763640..1763705 + 66 NuclAT_29 - -
- (1763640) 1763640..1763705 + 66 NuclAT_32 - -
- (1763640) 1763640..1763705 + 66 NuclAT_32 - -
- (1763640) 1763640..1763705 + 66 NuclAT_32 - -
- (1763640) 1763640..1763705 + 66 NuclAT_32 - -
- (1763640) 1763640..1763705 + 66 NuclAT_35 - -
- (1763640) 1763640..1763705 + 66 NuclAT_35 - -
- (1763640) 1763640..1763705 + 66 NuclAT_35 - -
- (1763640) 1763640..1763705 + 66 NuclAT_35 - -
- (1763640) 1763640..1763705 + 66 NuclAT_38 - -
- (1763640) 1763640..1763705 + 66 NuclAT_38 - -
- (1763640) 1763640..1763705 + 66 NuclAT_38 - -
- (1763640) 1763640..1763705 + 66 NuclAT_38 - -
- (1763640) 1763640..1763705 + 66 NuclAT_41 - -
- (1763640) 1763640..1763705 + 66 NuclAT_41 - -
- (1763640) 1763640..1763705 + 66 NuclAT_41 - -
- (1763640) 1763640..1763705 + 66 NuclAT_41 - -
- (1763640) 1763640..1763705 + 66 NuclAT_44 - -
- (1763640) 1763640..1763705 + 66 NuclAT_44 - -
- (1763640) 1763640..1763705 + 66 NuclAT_44 - -
- (1763640) 1763640..1763705 + 66 NuclAT_44 - -
- (1763640) 1763640..1763707 + 68 NuclAT_15 - -
- (1763640) 1763640..1763707 + 68 NuclAT_15 - -
- (1763640) 1763640..1763707 + 68 NuclAT_15 - -
- (1763640) 1763640..1763707 + 68 NuclAT_15 - -
- (1763640) 1763640..1763707 + 68 NuclAT_17 - -
- (1763640) 1763640..1763707 + 68 NuclAT_17 - -
- (1763640) 1763640..1763707 + 68 NuclAT_17 - -
- (1763640) 1763640..1763707 + 68 NuclAT_17 - -
- (1763640) 1763640..1763707 + 68 NuclAT_19 - -
- (1763640) 1763640..1763707 + 68 NuclAT_19 - -
- (1763640) 1763640..1763707 + 68 NuclAT_19 - -
- (1763640) 1763640..1763707 + 68 NuclAT_19 - -
- (1763640) 1763640..1763707 + 68 NuclAT_21 - -
- (1763640) 1763640..1763707 + 68 NuclAT_21 - -
- (1763640) 1763640..1763707 + 68 NuclAT_21 - -
- (1763640) 1763640..1763707 + 68 NuclAT_21 - -
- (1763640) 1763640..1763707 + 68 NuclAT_23 - -
- (1763640) 1763640..1763707 + 68 NuclAT_23 - -
- (1763640) 1763640..1763707 + 68 NuclAT_23 - -
- (1763640) 1763640..1763707 + 68 NuclAT_23 - -
- (1763640) 1763640..1763707 + 68 NuclAT_25 - -
- (1763640) 1763640..1763707 + 68 NuclAT_25 - -
- (1763640) 1763640..1763707 + 68 NuclAT_25 - -
- (1763640) 1763640..1763707 + 68 NuclAT_25 - -
QMG74_RS09180 (1763997) 1763997..1765097 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
QMG74_RS09185 (1765367) 1765367..1765597 + 231 WP_001146442.1 putative cation transport regulator ChaB -
QMG74_RS09190 (1765755) 1765755..1766450 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
QMG74_RS09195 (1766494) 1766494..1766847 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T43332 WP_000170954.1 NZ_AP027185:c1762521-1762414 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T43332 NZ_AP027185:c1762521-1762414 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT43332 NZ_AP027185:1762571-1762634 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References