Detailed information of TA system TA043282

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 108661..108930
• Replicon: plasmid pO26_EH2252_1
• Accession: NZ_AP027177
• Organism: Escherichia coli strain EH2252

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QMG71_RS30110
• Protein ID: WP_001372321.1
• Coordinates: 108805..108930 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	108661..108726 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QMG71_RS30070	103709..103981	+	273	WP_072133095.1	hypothetical protein	-
QMG71_RS30075	104454..104981	+	528	WP_000290793.1	single-stranded DNA-binding protein	-
QMG71_RS30080	105037..105270	+	234	WP_000006004.1	DUF905 domain-containing protein	-
QMG71_RS30085	105329..107287	+	1959	WP_001145469.1	ParB/RepB/Spo0J family partition protein	-
QMG71_RS30090	107342..107776	+	435	WP_000845895.1	conjugation system SOS inhibitor PsiB	-
QMG71_RS30095	107773..108535	+	763	Protein_121	plasmid SOS inhibition protein A	-
QMG71_RS30100	108504..108692	-	189	WP_001299721.1	hypothetical protein	-
-	108504..108728	+	225	NuclAT_0	-	-
-	108504..108728	+	225	NuclAT_0	-	-
-	108504..108728	+	225	NuclAT_0	-	-
-	108504..108728	+	225	NuclAT_0	-	-
-	108661..108726	+	66	-	-	Antitoxin
QMG71_RS30105	108714..108863	+	150	Protein_123	plasmid maintenance protein Mok	-
QMG71_RS30110	108805..108930	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QMG71_RS30115	109150..109380	+	231	WP_001426396.1	hypothetical protein	-
QMG71_RS30120	109378..109551	-	174	Protein_126	hypothetical protein	-
QMG71_RS30125	109621..109827	+	207	WP_000547939.1	hypothetical protein	-
QMG71_RS30130	109852..110139	+	288	WP_000107535.1	hypothetical protein	-
QMG71_RS30135	110260..111081	+	822	WP_001234469.1	DUF932 domain-containing protein	-
QMG71_RS30140	111378..111980	-	603	WP_000243709.1	transglycosylase SLT domain-containing protein	-
QMG71_RS30145	112301..112684	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QMG71_RS30150	112871..113560	+	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 / tet(A) / sitABCD	iroB / iroC / iroD / iroE / iroN	1..147858	147858

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T43282 WP_001372321.1 NZ_AP027177:108805-108930 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T43282 NZ_AP027177:108805-108930 [Escherichia coli]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT43282 NZ_AP027177:108661-108726 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC

Structures

Antitoxin