Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1739848..1740068 Replicon chromosome
Accession NZ_AP027176
Organism Escherichia coli strain EH2252

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag QMG71_RS09115 Protein ID WP_000170954.1
Coordinates 1739848..1739955 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1740005..1740068 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QMG71_RS09090 (1735692) 1735692..1736774 + 1083 WP_000804726.1 peptide chain release factor 1 -
QMG71_RS09095 (1736774) 1736774..1737607 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
QMG71_RS09100 (1737604) 1737604..1737996 + 393 WP_000200378.1 invasion regulator SirB2 -
QMG71_RS09105 (1738000) 1738000..1738809 + 810 WP_001257045.1 invasion regulator SirB1 -
QMG71_RS09110 (1738845) 1738845..1739699 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QMG71_RS09115 (1739848) 1739848..1739955 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1740005) 1740005..1740068 + 64 NuclAT_31 - Antitoxin
- (1740005) 1740005..1740068 + 64 NuclAT_31 - Antitoxin
- (1740005) 1740005..1740068 + 64 NuclAT_31 - Antitoxin
- (1740005) 1740005..1740068 + 64 NuclAT_31 - Antitoxin
- (1740005) 1740005..1740068 + 64 NuclAT_34 - Antitoxin
- (1740005) 1740005..1740068 + 64 NuclAT_34 - Antitoxin
- (1740005) 1740005..1740068 + 64 NuclAT_34 - Antitoxin
- (1740005) 1740005..1740068 + 64 NuclAT_34 - Antitoxin
- (1740005) 1740005..1740068 + 64 NuclAT_37 - Antitoxin
- (1740005) 1740005..1740068 + 64 NuclAT_37 - Antitoxin
- (1740005) 1740005..1740068 + 64 NuclAT_37 - Antitoxin
- (1740005) 1740005..1740068 + 64 NuclAT_37 - Antitoxin
- (1740005) 1740005..1740068 + 64 NuclAT_40 - Antitoxin
- (1740005) 1740005..1740068 + 64 NuclAT_40 - Antitoxin
- (1740005) 1740005..1740068 + 64 NuclAT_40 - Antitoxin
- (1740005) 1740005..1740068 + 64 NuclAT_40 - Antitoxin
- (1740005) 1740005..1740068 + 64 NuclAT_43 - Antitoxin
- (1740005) 1740005..1740068 + 64 NuclAT_43 - Antitoxin
- (1740005) 1740005..1740068 + 64 NuclAT_43 - Antitoxin
- (1740005) 1740005..1740068 + 64 NuclAT_43 - Antitoxin
- (1740005) 1740005..1740068 + 64 NuclAT_46 - Antitoxin
- (1740005) 1740005..1740068 + 64 NuclAT_46 - Antitoxin
- (1740005) 1740005..1740068 + 64 NuclAT_46 - Antitoxin
- (1740005) 1740005..1740068 + 64 NuclAT_46 - Antitoxin
QMG71_RS09120 (1740383) 1740383..1740490 - 108 WP_000170959.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1740543) 1740543..1740604 + 62 NuclAT_30 - -
- (1740543) 1740543..1740604 + 62 NuclAT_30 - -
- (1740543) 1740543..1740604 + 62 NuclAT_30 - -
- (1740543) 1740543..1740604 + 62 NuclAT_30 - -
- (1740543) 1740543..1740604 + 62 NuclAT_33 - -
- (1740543) 1740543..1740604 + 62 NuclAT_33 - -
- (1740543) 1740543..1740604 + 62 NuclAT_33 - -
- (1740543) 1740543..1740604 + 62 NuclAT_33 - -
- (1740543) 1740543..1740604 + 62 NuclAT_36 - -
- (1740543) 1740543..1740604 + 62 NuclAT_36 - -
- (1740543) 1740543..1740604 + 62 NuclAT_36 - -
- (1740543) 1740543..1740604 + 62 NuclAT_36 - -
- (1740543) 1740543..1740604 + 62 NuclAT_39 - -
- (1740543) 1740543..1740604 + 62 NuclAT_39 - -
- (1740543) 1740543..1740604 + 62 NuclAT_39 - -
- (1740543) 1740543..1740604 + 62 NuclAT_39 - -
- (1740543) 1740543..1740604 + 62 NuclAT_42 - -
- (1740543) 1740543..1740604 + 62 NuclAT_42 - -
- (1740543) 1740543..1740604 + 62 NuclAT_42 - -
- (1740543) 1740543..1740604 + 62 NuclAT_42 - -
- (1740543) 1740543..1740604 + 62 NuclAT_45 - -
- (1740543) 1740543..1740604 + 62 NuclAT_45 - -
- (1740543) 1740543..1740604 + 62 NuclAT_45 - -
- (1740543) 1740543..1740604 + 62 NuclAT_45 - -
- (1740543) 1740543..1740606 + 64 NuclAT_16 - -
- (1740543) 1740543..1740606 + 64 NuclAT_16 - -
- (1740543) 1740543..1740606 + 64 NuclAT_16 - -
- (1740543) 1740543..1740606 + 64 NuclAT_16 - -
- (1740543) 1740543..1740606 + 64 NuclAT_18 - -
- (1740543) 1740543..1740606 + 64 NuclAT_18 - -
- (1740543) 1740543..1740606 + 64 NuclAT_18 - -
- (1740543) 1740543..1740606 + 64 NuclAT_18 - -
- (1740543) 1740543..1740606 + 64 NuclAT_20 - -
- (1740543) 1740543..1740606 + 64 NuclAT_20 - -
- (1740543) 1740543..1740606 + 64 NuclAT_20 - -
- (1740543) 1740543..1740606 + 64 NuclAT_20 - -
- (1740543) 1740543..1740606 + 64 NuclAT_22 - -
- (1740543) 1740543..1740606 + 64 NuclAT_22 - -
- (1740543) 1740543..1740606 + 64 NuclAT_22 - -
- (1740543) 1740543..1740606 + 64 NuclAT_22 - -
- (1740543) 1740543..1740606 + 64 NuclAT_24 - -
- (1740543) 1740543..1740606 + 64 NuclAT_24 - -
- (1740543) 1740543..1740606 + 64 NuclAT_24 - -
- (1740543) 1740543..1740606 + 64 NuclAT_24 - -
- (1740543) 1740543..1740606 + 64 NuclAT_26 - -
- (1740543) 1740543..1740606 + 64 NuclAT_26 - -
- (1740543) 1740543..1740606 + 64 NuclAT_26 - -
- (1740543) 1740543..1740606 + 64 NuclAT_26 - -
QMG71_RS09125 (1740919) 1740919..1741026 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1741074) 1741074..1741139 + 66 NuclAT_29 - -
- (1741074) 1741074..1741139 + 66 NuclAT_29 - -
- (1741074) 1741074..1741139 + 66 NuclAT_29 - -
- (1741074) 1741074..1741139 + 66 NuclAT_29 - -
- (1741074) 1741074..1741139 + 66 NuclAT_32 - -
- (1741074) 1741074..1741139 + 66 NuclAT_32 - -
- (1741074) 1741074..1741139 + 66 NuclAT_32 - -
- (1741074) 1741074..1741139 + 66 NuclAT_32 - -
- (1741074) 1741074..1741139 + 66 NuclAT_35 - -
- (1741074) 1741074..1741139 + 66 NuclAT_35 - -
- (1741074) 1741074..1741139 + 66 NuclAT_35 - -
- (1741074) 1741074..1741139 + 66 NuclAT_35 - -
- (1741074) 1741074..1741139 + 66 NuclAT_38 - -
- (1741074) 1741074..1741139 + 66 NuclAT_38 - -
- (1741074) 1741074..1741139 + 66 NuclAT_38 - -
- (1741074) 1741074..1741139 + 66 NuclAT_38 - -
- (1741074) 1741074..1741139 + 66 NuclAT_41 - -
- (1741074) 1741074..1741139 + 66 NuclAT_41 - -
- (1741074) 1741074..1741139 + 66 NuclAT_41 - -
- (1741074) 1741074..1741139 + 66 NuclAT_41 - -
- (1741074) 1741074..1741139 + 66 NuclAT_44 - -
- (1741074) 1741074..1741139 + 66 NuclAT_44 - -
- (1741074) 1741074..1741139 + 66 NuclAT_44 - -
- (1741074) 1741074..1741139 + 66 NuclAT_44 - -
- (1741074) 1741074..1741141 + 68 NuclAT_15 - -
- (1741074) 1741074..1741141 + 68 NuclAT_15 - -
- (1741074) 1741074..1741141 + 68 NuclAT_15 - -
- (1741074) 1741074..1741141 + 68 NuclAT_15 - -
- (1741074) 1741074..1741141 + 68 NuclAT_17 - -
- (1741074) 1741074..1741141 + 68 NuclAT_17 - -
- (1741074) 1741074..1741141 + 68 NuclAT_17 - -
- (1741074) 1741074..1741141 + 68 NuclAT_17 - -
- (1741074) 1741074..1741141 + 68 NuclAT_19 - -
- (1741074) 1741074..1741141 + 68 NuclAT_19 - -
- (1741074) 1741074..1741141 + 68 NuclAT_19 - -
- (1741074) 1741074..1741141 + 68 NuclAT_19 - -
- (1741074) 1741074..1741141 + 68 NuclAT_21 - -
- (1741074) 1741074..1741141 + 68 NuclAT_21 - -
- (1741074) 1741074..1741141 + 68 NuclAT_21 - -
- (1741074) 1741074..1741141 + 68 NuclAT_21 - -
- (1741074) 1741074..1741141 + 68 NuclAT_23 - -
- (1741074) 1741074..1741141 + 68 NuclAT_23 - -
- (1741074) 1741074..1741141 + 68 NuclAT_23 - -
- (1741074) 1741074..1741141 + 68 NuclAT_23 - -
- (1741074) 1741074..1741141 + 68 NuclAT_25 - -
- (1741074) 1741074..1741141 + 68 NuclAT_25 - -
- (1741074) 1741074..1741141 + 68 NuclAT_25 - -
- (1741074) 1741074..1741141 + 68 NuclAT_25 - -
QMG71_RS09130 (1741431) 1741431..1742531 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
QMG71_RS09135 (1742801) 1742801..1743031 + 231 WP_001146442.1 putative cation transport regulator ChaB -
QMG71_RS09140 (1743189) 1743189..1743884 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
QMG71_RS09145 (1743928) 1743928..1744281 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T43249 WP_000170954.1 NZ_AP027176:c1739955-1739848 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T43249 NZ_AP027176:c1739955-1739848 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT43249 NZ_AP027176:1740005-1740068 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9


Antitoxin

Download structure file

References