Detailed information of TA system TA043238

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 90366..90635
• Replicon: plasmid pO26_20.1_1
• Accession: NZ_AP027171
• Organism: Escherichia coli strain 20.1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QMG87_RS29385
• Protein ID: WP_001372321.1
• Coordinates: 90510..90635 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	90366..90431 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QMG87_RS29345	85420..85686	+	267	WP_072254135.1	hypothetical protein	-
QMG87_RS29350	86159..86686	+	528	WP_000290793.1	single-stranded DNA-binding protein	-
QMG87_RS29355	86742..86975	+	234	WP_000006004.1	DUF905 domain-containing protein	-
QMG87_RS29360	87034..88992	+	1959	WP_001145469.1	ParB/RepB/Spo0J family partition protein	-
QMG87_RS29365	89047..89481	+	435	WP_000845895.1	conjugation system SOS inhibitor PsiB	-
QMG87_RS29370	89478..90240	+	763	Protein_101	plasmid SOS inhibition protein A	-
QMG87_RS29375	90209..90397	-	189	WP_001299721.1	hypothetical protein	-
-	90209..90433	+	225	NuclAT_0	-	-
-	90209..90433	+	225	NuclAT_0	-	-
-	90209..90433	+	225	NuclAT_0	-	-
-	90209..90433	+	225	NuclAT_0	-	-
-	90366..90431	+	66	-	-	Antitoxin
QMG87_RS29380	90419..90568	+	150	Protein_103	plasmid maintenance protein Mok	-
QMG87_RS29385	90510..90635	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QMG87_RS29390	90855..91085	+	231	WP_001426396.1	hypothetical protein	-
QMG87_RS29395	91083..91256	-	174	Protein_106	hypothetical protein	-
QMG87_RS29400	91326..91532	+	207	WP_000547939.1	hypothetical protein	-
QMG87_RS29405	91557..91844	+	288	WP_000107535.1	hypothetical protein	-
QMG87_RS29410	91965..92786	+	822	WP_001234469.1	DUF932 domain-containing protein	-
QMG87_RS29415	93083..93685	-	603	WP_000243709.1	transglycosylase SLT domain-containing protein	-
QMG87_RS29420	94006..94389	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QMG87_RS29425	94576..95265	+	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	aph(6)-Id / aph(3'')-Ib / sul2 / sitABCD	iroN / iroE / iroD / iroC / iroB	1..129563	129563

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T43238 WP_001372321.1 NZ_AP027171:90510-90635 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T43238 NZ_AP027171:90510-90635 [Escherichia coli]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT43238 NZ_AP027171:90366-90431 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC

Structures

Antitoxin