Detailed information of TA system TA043197

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 41946..42215
• Replicon: plasmid pO26_H19_3
• Accession: NZ_AP027168
• Organism: Escherichia coli strain H19

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QMG77_RS29255
• Protein ID: WP_001372321.1
• Coordinates: 42090..42215 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	41946..42011 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QMG77_RS29215	37021..37269	+	249	WP_071606928.1	hypothetical protein	-
QMG77_RS29220	37739..38266	+	528	WP_000290793.1	single-stranded DNA-binding protein	-
QMG77_RS29225	38322..38555	+	234	WP_000006004.1	DUF905 domain-containing protein	-
QMG77_RS29230	38614..40572	+	1959	WP_001145469.1	ParB/RepB/Spo0J family partition protein	-
QMG77_RS29235	40627..41061	+	435	WP_000845901.1	conjugation system SOS inhibitor PsiB	-
QMG77_RS29240	41058..41820	+	763	Protein_56	plasmid SOS inhibition protein A	-
QMG77_RS29245	41789..41977	-	189	WP_001299721.1	hypothetical protein	-
-	41789..42013	+	225	NuclAT_0	-	-
-	41789..42013	+	225	NuclAT_0	-	-
-	41789..42013	+	225	NuclAT_0	-	-
-	41789..42013	+	225	NuclAT_0	-	-
-	41946..42011	+	66	-	-	Antitoxin
QMG77_RS29250	41999..42148	+	150	Protein_58	plasmid maintenance protein Mok	-
QMG77_RS29255	42090..42215	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QMG77_RS29260	42435..42665	+	231	WP_071587244.1	hypothetical protein	-
QMG77_RS29265	42663..42836	-	174	Protein_61	hypothetical protein	-
QMG77_RS29270	43134..43421	+	288	WP_000107537.1	hypothetical protein	-
QMG77_RS29275	43542..44363	+	822	WP_001234469.1	DUF932 domain-containing protein	-
QMG77_RS29280	44660..45307	-	648	WP_000614282.1	transglycosylase SLT domain-containing protein	-
QMG77_RS29285	45593..45976	+	384	WP_001151564.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QMG77_RS29290	46170..46856	+	687	WP_000332487.1	PAS domain-containing protein	-
QMG77_RS29295	46950..47177	+	228	WP_001254388.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T43197 WP_001372321.1 NZ_AP027168:42090-42215 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T43197 NZ_AP027168:42090-42215 [Escherichia coli]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT43197 NZ_AP027168:41946-42011 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC

Structures

Antitoxin