Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1318989..1319209 Replicon chromosome
Accession NZ_AP027165
Organism Escherichia coli strain H19

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag QMG77_RS06635 Protein ID WP_000170954.1
Coordinates 1318989..1319096 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1319146..1319209 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QMG77_RS06610 (1314833) 1314833..1315915 + 1083 WP_000804726.1 peptide chain release factor 1 -
QMG77_RS06615 (1315915) 1315915..1316748 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
QMG77_RS06620 (1316745) 1316745..1317137 + 393 WP_000200378.1 invasion regulator SirB2 -
QMG77_RS06625 (1317141) 1317141..1317950 + 810 WP_001257045.1 invasion regulator SirB1 -
QMG77_RS06630 (1317986) 1317986..1318840 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QMG77_RS06635 (1318989) 1318989..1319096 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1319146) 1319146..1319209 + 64 NuclAT_32 - Antitoxin
- (1319146) 1319146..1319209 + 64 NuclAT_32 - Antitoxin
- (1319146) 1319146..1319209 + 64 NuclAT_32 - Antitoxin
- (1319146) 1319146..1319209 + 64 NuclAT_32 - Antitoxin
- (1319146) 1319146..1319209 + 64 NuclAT_35 - Antitoxin
- (1319146) 1319146..1319209 + 64 NuclAT_35 - Antitoxin
- (1319146) 1319146..1319209 + 64 NuclAT_35 - Antitoxin
- (1319146) 1319146..1319209 + 64 NuclAT_35 - Antitoxin
- (1319146) 1319146..1319209 + 64 NuclAT_38 - Antitoxin
- (1319146) 1319146..1319209 + 64 NuclAT_38 - Antitoxin
- (1319146) 1319146..1319209 + 64 NuclAT_38 - Antitoxin
- (1319146) 1319146..1319209 + 64 NuclAT_38 - Antitoxin
- (1319146) 1319146..1319209 + 64 NuclAT_41 - Antitoxin
- (1319146) 1319146..1319209 + 64 NuclAT_41 - Antitoxin
- (1319146) 1319146..1319209 + 64 NuclAT_41 - Antitoxin
- (1319146) 1319146..1319209 + 64 NuclAT_41 - Antitoxin
- (1319146) 1319146..1319209 + 64 NuclAT_44 - Antitoxin
- (1319146) 1319146..1319209 + 64 NuclAT_44 - Antitoxin
- (1319146) 1319146..1319209 + 64 NuclAT_44 - Antitoxin
- (1319146) 1319146..1319209 + 64 NuclAT_44 - Antitoxin
- (1319146) 1319146..1319209 + 64 NuclAT_47 - Antitoxin
- (1319146) 1319146..1319209 + 64 NuclAT_47 - Antitoxin
- (1319146) 1319146..1319209 + 64 NuclAT_47 - Antitoxin
- (1319146) 1319146..1319209 + 64 NuclAT_47 - Antitoxin
QMG77_RS06640 (1319524) 1319524..1319631 - 108 WP_000170959.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1319684) 1319684..1319745 + 62 NuclAT_31 - -
- (1319684) 1319684..1319745 + 62 NuclAT_31 - -
- (1319684) 1319684..1319745 + 62 NuclAT_31 - -
- (1319684) 1319684..1319745 + 62 NuclAT_31 - -
- (1319684) 1319684..1319745 + 62 NuclAT_34 - -
- (1319684) 1319684..1319745 + 62 NuclAT_34 - -
- (1319684) 1319684..1319745 + 62 NuclAT_34 - -
- (1319684) 1319684..1319745 + 62 NuclAT_34 - -
- (1319684) 1319684..1319745 + 62 NuclAT_37 - -
- (1319684) 1319684..1319745 + 62 NuclAT_37 - -
- (1319684) 1319684..1319745 + 62 NuclAT_37 - -
- (1319684) 1319684..1319745 + 62 NuclAT_37 - -
- (1319684) 1319684..1319745 + 62 NuclAT_40 - -
- (1319684) 1319684..1319745 + 62 NuclAT_40 - -
- (1319684) 1319684..1319745 + 62 NuclAT_40 - -
- (1319684) 1319684..1319745 + 62 NuclAT_40 - -
- (1319684) 1319684..1319745 + 62 NuclAT_43 - -
- (1319684) 1319684..1319745 + 62 NuclAT_43 - -
- (1319684) 1319684..1319745 + 62 NuclAT_43 - -
- (1319684) 1319684..1319745 + 62 NuclAT_43 - -
- (1319684) 1319684..1319745 + 62 NuclAT_46 - -
- (1319684) 1319684..1319745 + 62 NuclAT_46 - -
- (1319684) 1319684..1319745 + 62 NuclAT_46 - -
- (1319684) 1319684..1319745 + 62 NuclAT_46 - -
- (1319684) 1319684..1319747 + 64 NuclAT_17 - -
- (1319684) 1319684..1319747 + 64 NuclAT_17 - -
- (1319684) 1319684..1319747 + 64 NuclAT_17 - -
- (1319684) 1319684..1319747 + 64 NuclAT_17 - -
- (1319684) 1319684..1319747 + 64 NuclAT_19 - -
- (1319684) 1319684..1319747 + 64 NuclAT_19 - -
- (1319684) 1319684..1319747 + 64 NuclAT_19 - -
- (1319684) 1319684..1319747 + 64 NuclAT_19 - -
- (1319684) 1319684..1319747 + 64 NuclAT_21 - -
- (1319684) 1319684..1319747 + 64 NuclAT_21 - -
- (1319684) 1319684..1319747 + 64 NuclAT_21 - -
- (1319684) 1319684..1319747 + 64 NuclAT_21 - -
- (1319684) 1319684..1319747 + 64 NuclAT_23 - -
- (1319684) 1319684..1319747 + 64 NuclAT_23 - -
- (1319684) 1319684..1319747 + 64 NuclAT_23 - -
- (1319684) 1319684..1319747 + 64 NuclAT_23 - -
- (1319684) 1319684..1319747 + 64 NuclAT_25 - -
- (1319684) 1319684..1319747 + 64 NuclAT_25 - -
- (1319684) 1319684..1319747 + 64 NuclAT_25 - -
- (1319684) 1319684..1319747 + 64 NuclAT_25 - -
- (1319684) 1319684..1319747 + 64 NuclAT_27 - -
- (1319684) 1319684..1319747 + 64 NuclAT_27 - -
- (1319684) 1319684..1319747 + 64 NuclAT_27 - -
- (1319684) 1319684..1319747 + 64 NuclAT_27 - -
QMG77_RS06645 (1320060) 1320060..1320167 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1320215) 1320215..1320280 + 66 NuclAT_30 - -
- (1320215) 1320215..1320280 + 66 NuclAT_30 - -
- (1320215) 1320215..1320280 + 66 NuclAT_30 - -
- (1320215) 1320215..1320280 + 66 NuclAT_30 - -
- (1320215) 1320215..1320280 + 66 NuclAT_33 - -
- (1320215) 1320215..1320280 + 66 NuclAT_33 - -
- (1320215) 1320215..1320280 + 66 NuclAT_33 - -
- (1320215) 1320215..1320280 + 66 NuclAT_33 - -
- (1320215) 1320215..1320280 + 66 NuclAT_36 - -
- (1320215) 1320215..1320280 + 66 NuclAT_36 - -
- (1320215) 1320215..1320280 + 66 NuclAT_36 - -
- (1320215) 1320215..1320280 + 66 NuclAT_36 - -
- (1320215) 1320215..1320280 + 66 NuclAT_39 - -
- (1320215) 1320215..1320280 + 66 NuclAT_39 - -
- (1320215) 1320215..1320280 + 66 NuclAT_39 - -
- (1320215) 1320215..1320280 + 66 NuclAT_39 - -
- (1320215) 1320215..1320280 + 66 NuclAT_42 - -
- (1320215) 1320215..1320280 + 66 NuclAT_42 - -
- (1320215) 1320215..1320280 + 66 NuclAT_42 - -
- (1320215) 1320215..1320280 + 66 NuclAT_42 - -
- (1320215) 1320215..1320280 + 66 NuclAT_45 - -
- (1320215) 1320215..1320280 + 66 NuclAT_45 - -
- (1320215) 1320215..1320280 + 66 NuclAT_45 - -
- (1320215) 1320215..1320280 + 66 NuclAT_45 - -
- (1320215) 1320215..1320282 + 68 NuclAT_16 - -
- (1320215) 1320215..1320282 + 68 NuclAT_16 - -
- (1320215) 1320215..1320282 + 68 NuclAT_16 - -
- (1320215) 1320215..1320282 + 68 NuclAT_16 - -
- (1320215) 1320215..1320282 + 68 NuclAT_18 - -
- (1320215) 1320215..1320282 + 68 NuclAT_18 - -
- (1320215) 1320215..1320282 + 68 NuclAT_18 - -
- (1320215) 1320215..1320282 + 68 NuclAT_18 - -
- (1320215) 1320215..1320282 + 68 NuclAT_20 - -
- (1320215) 1320215..1320282 + 68 NuclAT_20 - -
- (1320215) 1320215..1320282 + 68 NuclAT_20 - -
- (1320215) 1320215..1320282 + 68 NuclAT_20 - -
- (1320215) 1320215..1320282 + 68 NuclAT_22 - -
- (1320215) 1320215..1320282 + 68 NuclAT_22 - -
- (1320215) 1320215..1320282 + 68 NuclAT_22 - -
- (1320215) 1320215..1320282 + 68 NuclAT_22 - -
- (1320215) 1320215..1320282 + 68 NuclAT_24 - -
- (1320215) 1320215..1320282 + 68 NuclAT_24 - -
- (1320215) 1320215..1320282 + 68 NuclAT_24 - -
- (1320215) 1320215..1320282 + 68 NuclAT_24 - -
- (1320215) 1320215..1320282 + 68 NuclAT_26 - -
- (1320215) 1320215..1320282 + 68 NuclAT_26 - -
- (1320215) 1320215..1320282 + 68 NuclAT_26 - -
- (1320215) 1320215..1320282 + 68 NuclAT_26 - -
QMG77_RS06650 (1320572) 1320572..1321672 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
QMG77_RS06655 (1321942) 1321942..1322172 + 231 WP_001146442.1 putative cation transport regulator ChaB -
QMG77_RS06660 (1322330) 1322330..1323025 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
QMG77_RS06665 (1323069) 1323069..1323422 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T43163 WP_000170954.1 NZ_AP027165:c1319096-1318989 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T43163 NZ_AP027165:c1319096-1318989 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT43163 NZ_AP027165:1319146-1319209 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References