Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1318989..1319209 | Replicon | chromosome |
| Accession | NZ_AP027165 | ||
| Organism | Escherichia coli strain H19 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1PGT3 |
| Locus tag | QMG77_RS06635 | Protein ID | WP_000170954.1 |
| Coordinates | 1318989..1319096 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1319146..1319209 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMG77_RS06610 (1314833) | 1314833..1315915 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| QMG77_RS06615 (1315915) | 1315915..1316748 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| QMG77_RS06620 (1316745) | 1316745..1317137 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| QMG77_RS06625 (1317141) | 1317141..1317950 | + | 810 | WP_001257045.1 | invasion regulator SirB1 | - |
| QMG77_RS06630 (1317986) | 1317986..1318840 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| QMG77_RS06635 (1318989) | 1318989..1319096 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (1319146) | 1319146..1319209 | + | 64 | NuclAT_32 | - | Antitoxin |
| - (1319146) | 1319146..1319209 | + | 64 | NuclAT_32 | - | Antitoxin |
| - (1319146) | 1319146..1319209 | + | 64 | NuclAT_32 | - | Antitoxin |
| - (1319146) | 1319146..1319209 | + | 64 | NuclAT_32 | - | Antitoxin |
| - (1319146) | 1319146..1319209 | + | 64 | NuclAT_35 | - | Antitoxin |
| - (1319146) | 1319146..1319209 | + | 64 | NuclAT_35 | - | Antitoxin |
| - (1319146) | 1319146..1319209 | + | 64 | NuclAT_35 | - | Antitoxin |
| - (1319146) | 1319146..1319209 | + | 64 | NuclAT_35 | - | Antitoxin |
| - (1319146) | 1319146..1319209 | + | 64 | NuclAT_38 | - | Antitoxin |
| - (1319146) | 1319146..1319209 | + | 64 | NuclAT_38 | - | Antitoxin |
| - (1319146) | 1319146..1319209 | + | 64 | NuclAT_38 | - | Antitoxin |
| - (1319146) | 1319146..1319209 | + | 64 | NuclAT_38 | - | Antitoxin |
| - (1319146) | 1319146..1319209 | + | 64 | NuclAT_41 | - | Antitoxin |
| - (1319146) | 1319146..1319209 | + | 64 | NuclAT_41 | - | Antitoxin |
| - (1319146) | 1319146..1319209 | + | 64 | NuclAT_41 | - | Antitoxin |
| - (1319146) | 1319146..1319209 | + | 64 | NuclAT_41 | - | Antitoxin |
| - (1319146) | 1319146..1319209 | + | 64 | NuclAT_44 | - | Antitoxin |
| - (1319146) | 1319146..1319209 | + | 64 | NuclAT_44 | - | Antitoxin |
| - (1319146) | 1319146..1319209 | + | 64 | NuclAT_44 | - | Antitoxin |
| - (1319146) | 1319146..1319209 | + | 64 | NuclAT_44 | - | Antitoxin |
| - (1319146) | 1319146..1319209 | + | 64 | NuclAT_47 | - | Antitoxin |
| - (1319146) | 1319146..1319209 | + | 64 | NuclAT_47 | - | Antitoxin |
| - (1319146) | 1319146..1319209 | + | 64 | NuclAT_47 | - | Antitoxin |
| - (1319146) | 1319146..1319209 | + | 64 | NuclAT_47 | - | Antitoxin |
| QMG77_RS06640 (1319524) | 1319524..1319631 | - | 108 | WP_000170959.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1319684) | 1319684..1319745 | + | 62 | NuclAT_31 | - | - |
| - (1319684) | 1319684..1319745 | + | 62 | NuclAT_31 | - | - |
| - (1319684) | 1319684..1319745 | + | 62 | NuclAT_31 | - | - |
| - (1319684) | 1319684..1319745 | + | 62 | NuclAT_31 | - | - |
| - (1319684) | 1319684..1319745 | + | 62 | NuclAT_34 | - | - |
| - (1319684) | 1319684..1319745 | + | 62 | NuclAT_34 | - | - |
| - (1319684) | 1319684..1319745 | + | 62 | NuclAT_34 | - | - |
| - (1319684) | 1319684..1319745 | + | 62 | NuclAT_34 | - | - |
| - (1319684) | 1319684..1319745 | + | 62 | NuclAT_37 | - | - |
| - (1319684) | 1319684..1319745 | + | 62 | NuclAT_37 | - | - |
| - (1319684) | 1319684..1319745 | + | 62 | NuclAT_37 | - | - |
| - (1319684) | 1319684..1319745 | + | 62 | NuclAT_37 | - | - |
| - (1319684) | 1319684..1319745 | + | 62 | NuclAT_40 | - | - |
| - (1319684) | 1319684..1319745 | + | 62 | NuclAT_40 | - | - |
| - (1319684) | 1319684..1319745 | + | 62 | NuclAT_40 | - | - |
| - (1319684) | 1319684..1319745 | + | 62 | NuclAT_40 | - | - |
| - (1319684) | 1319684..1319745 | + | 62 | NuclAT_43 | - | - |
| - (1319684) | 1319684..1319745 | + | 62 | NuclAT_43 | - | - |
| - (1319684) | 1319684..1319745 | + | 62 | NuclAT_43 | - | - |
| - (1319684) | 1319684..1319745 | + | 62 | NuclAT_43 | - | - |
| - (1319684) | 1319684..1319745 | + | 62 | NuclAT_46 | - | - |
| - (1319684) | 1319684..1319745 | + | 62 | NuclAT_46 | - | - |
| - (1319684) | 1319684..1319745 | + | 62 | NuclAT_46 | - | - |
| - (1319684) | 1319684..1319745 | + | 62 | NuclAT_46 | - | - |
| - (1319684) | 1319684..1319747 | + | 64 | NuclAT_17 | - | - |
| - (1319684) | 1319684..1319747 | + | 64 | NuclAT_17 | - | - |
| - (1319684) | 1319684..1319747 | + | 64 | NuclAT_17 | - | - |
| - (1319684) | 1319684..1319747 | + | 64 | NuclAT_17 | - | - |
| - (1319684) | 1319684..1319747 | + | 64 | NuclAT_19 | - | - |
| - (1319684) | 1319684..1319747 | + | 64 | NuclAT_19 | - | - |
| - (1319684) | 1319684..1319747 | + | 64 | NuclAT_19 | - | - |
| - (1319684) | 1319684..1319747 | + | 64 | NuclAT_19 | - | - |
| - (1319684) | 1319684..1319747 | + | 64 | NuclAT_21 | - | - |
| - (1319684) | 1319684..1319747 | + | 64 | NuclAT_21 | - | - |
| - (1319684) | 1319684..1319747 | + | 64 | NuclAT_21 | - | - |
| - (1319684) | 1319684..1319747 | + | 64 | NuclAT_21 | - | - |
| - (1319684) | 1319684..1319747 | + | 64 | NuclAT_23 | - | - |
| - (1319684) | 1319684..1319747 | + | 64 | NuclAT_23 | - | - |
| - (1319684) | 1319684..1319747 | + | 64 | NuclAT_23 | - | - |
| - (1319684) | 1319684..1319747 | + | 64 | NuclAT_23 | - | - |
| - (1319684) | 1319684..1319747 | + | 64 | NuclAT_25 | - | - |
| - (1319684) | 1319684..1319747 | + | 64 | NuclAT_25 | - | - |
| - (1319684) | 1319684..1319747 | + | 64 | NuclAT_25 | - | - |
| - (1319684) | 1319684..1319747 | + | 64 | NuclAT_25 | - | - |
| - (1319684) | 1319684..1319747 | + | 64 | NuclAT_27 | - | - |
| - (1319684) | 1319684..1319747 | + | 64 | NuclAT_27 | - | - |
| - (1319684) | 1319684..1319747 | + | 64 | NuclAT_27 | - | - |
| - (1319684) | 1319684..1319747 | + | 64 | NuclAT_27 | - | - |
| QMG77_RS06645 (1320060) | 1320060..1320167 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1320215) | 1320215..1320280 | + | 66 | NuclAT_30 | - | - |
| - (1320215) | 1320215..1320280 | + | 66 | NuclAT_30 | - | - |
| - (1320215) | 1320215..1320280 | + | 66 | NuclAT_30 | - | - |
| - (1320215) | 1320215..1320280 | + | 66 | NuclAT_30 | - | - |
| - (1320215) | 1320215..1320280 | + | 66 | NuclAT_33 | - | - |
| - (1320215) | 1320215..1320280 | + | 66 | NuclAT_33 | - | - |
| - (1320215) | 1320215..1320280 | + | 66 | NuclAT_33 | - | - |
| - (1320215) | 1320215..1320280 | + | 66 | NuclAT_33 | - | - |
| - (1320215) | 1320215..1320280 | + | 66 | NuclAT_36 | - | - |
| - (1320215) | 1320215..1320280 | + | 66 | NuclAT_36 | - | - |
| - (1320215) | 1320215..1320280 | + | 66 | NuclAT_36 | - | - |
| - (1320215) | 1320215..1320280 | + | 66 | NuclAT_36 | - | - |
| - (1320215) | 1320215..1320280 | + | 66 | NuclAT_39 | - | - |
| - (1320215) | 1320215..1320280 | + | 66 | NuclAT_39 | - | - |
| - (1320215) | 1320215..1320280 | + | 66 | NuclAT_39 | - | - |
| - (1320215) | 1320215..1320280 | + | 66 | NuclAT_39 | - | - |
| - (1320215) | 1320215..1320280 | + | 66 | NuclAT_42 | - | - |
| - (1320215) | 1320215..1320280 | + | 66 | NuclAT_42 | - | - |
| - (1320215) | 1320215..1320280 | + | 66 | NuclAT_42 | - | - |
| - (1320215) | 1320215..1320280 | + | 66 | NuclAT_42 | - | - |
| - (1320215) | 1320215..1320280 | + | 66 | NuclAT_45 | - | - |
| - (1320215) | 1320215..1320280 | + | 66 | NuclAT_45 | - | - |
| - (1320215) | 1320215..1320280 | + | 66 | NuclAT_45 | - | - |
| - (1320215) | 1320215..1320280 | + | 66 | NuclAT_45 | - | - |
| - (1320215) | 1320215..1320282 | + | 68 | NuclAT_16 | - | - |
| - (1320215) | 1320215..1320282 | + | 68 | NuclAT_16 | - | - |
| - (1320215) | 1320215..1320282 | + | 68 | NuclAT_16 | - | - |
| - (1320215) | 1320215..1320282 | + | 68 | NuclAT_16 | - | - |
| - (1320215) | 1320215..1320282 | + | 68 | NuclAT_18 | - | - |
| - (1320215) | 1320215..1320282 | + | 68 | NuclAT_18 | - | - |
| - (1320215) | 1320215..1320282 | + | 68 | NuclAT_18 | - | - |
| - (1320215) | 1320215..1320282 | + | 68 | NuclAT_18 | - | - |
| - (1320215) | 1320215..1320282 | + | 68 | NuclAT_20 | - | - |
| - (1320215) | 1320215..1320282 | + | 68 | NuclAT_20 | - | - |
| - (1320215) | 1320215..1320282 | + | 68 | NuclAT_20 | - | - |
| - (1320215) | 1320215..1320282 | + | 68 | NuclAT_20 | - | - |
| - (1320215) | 1320215..1320282 | + | 68 | NuclAT_22 | - | - |
| - (1320215) | 1320215..1320282 | + | 68 | NuclAT_22 | - | - |
| - (1320215) | 1320215..1320282 | + | 68 | NuclAT_22 | - | - |
| - (1320215) | 1320215..1320282 | + | 68 | NuclAT_22 | - | - |
| - (1320215) | 1320215..1320282 | + | 68 | NuclAT_24 | - | - |
| - (1320215) | 1320215..1320282 | + | 68 | NuclAT_24 | - | - |
| - (1320215) | 1320215..1320282 | + | 68 | NuclAT_24 | - | - |
| - (1320215) | 1320215..1320282 | + | 68 | NuclAT_24 | - | - |
| - (1320215) | 1320215..1320282 | + | 68 | NuclAT_26 | - | - |
| - (1320215) | 1320215..1320282 | + | 68 | NuclAT_26 | - | - |
| - (1320215) | 1320215..1320282 | + | 68 | NuclAT_26 | - | - |
| - (1320215) | 1320215..1320282 | + | 68 | NuclAT_26 | - | - |
| QMG77_RS06650 (1320572) | 1320572..1321672 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| QMG77_RS06655 (1321942) | 1321942..1322172 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| QMG77_RS06660 (1322330) | 1322330..1323025 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| QMG77_RS06665 (1323069) | 1323069..1323422 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T43163 WP_000170954.1 NZ_AP027165:c1319096-1318989 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T43163 NZ_AP027165:c1319096-1318989 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 64 bp
>AT43163 NZ_AP027165:1319146-1319209 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|