Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
| Location | 1299732..1299954 | Replicon | chromosome |
| Accession | NZ_AP027156 | ||
| Organism | Escherichia coli strain JNE181771 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | B7LGX8 |
| Locus tag | QUD66_RS06160 | Protein ID | WP_000170965.1 |
| Coordinates | 1299732..1299839 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 1299887..1299954 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QUD66_RS06130 (1295587) | 1295587..1296420 | + | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| QUD66_RS06135 (1296417) | 1296417..1296809 | + | 393 | WP_000200392.1 | invasion regulator SirB2 | - |
| QUD66_RS06140 (1296813) | 1296813..1297622 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| QUD66_RS06145 (1297658) | 1297658..1298512 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| QUD66_RS06150 (1298661) | 1298661..1298768 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1298818) | 1298818..1298881 | + | 64 | NuclAT_39 | - | - |
| - (1298818) | 1298818..1298881 | + | 64 | NuclAT_39 | - | - |
| - (1298818) | 1298818..1298881 | + | 64 | NuclAT_39 | - | - |
| - (1298818) | 1298818..1298881 | + | 64 | NuclAT_39 | - | - |
| - (1298818) | 1298818..1298881 | + | 64 | NuclAT_41 | - | - |
| - (1298818) | 1298818..1298881 | + | 64 | NuclAT_41 | - | - |
| - (1298818) | 1298818..1298881 | + | 64 | NuclAT_41 | - | - |
| - (1298818) | 1298818..1298881 | + | 64 | NuclAT_41 | - | - |
| - (1298818) | 1298818..1298881 | + | 64 | NuclAT_43 | - | - |
| - (1298818) | 1298818..1298881 | + | 64 | NuclAT_43 | - | - |
| - (1298818) | 1298818..1298881 | + | 64 | NuclAT_43 | - | - |
| - (1298818) | 1298818..1298881 | + | 64 | NuclAT_43 | - | - |
| - (1298816) | 1298816..1298882 | + | 67 | NuclAT_26 | - | - |
| - (1298816) | 1298816..1298882 | + | 67 | NuclAT_26 | - | - |
| - (1298816) | 1298816..1298882 | + | 67 | NuclAT_26 | - | - |
| - (1298816) | 1298816..1298882 | + | 67 | NuclAT_26 | - | - |
| - (1298816) | 1298816..1298882 | + | 67 | NuclAT_28 | - | - |
| - (1298816) | 1298816..1298882 | + | 67 | NuclAT_28 | - | - |
| - (1298816) | 1298816..1298882 | + | 67 | NuclAT_28 | - | - |
| - (1298816) | 1298816..1298882 | + | 67 | NuclAT_28 | - | - |
| - (1298816) | 1298816..1298882 | + | 67 | NuclAT_30 | - | - |
| - (1298816) | 1298816..1298882 | + | 67 | NuclAT_30 | - | - |
| - (1298816) | 1298816..1298882 | + | 67 | NuclAT_30 | - | - |
| - (1298816) | 1298816..1298882 | + | 67 | NuclAT_30 | - | - |
| - (1298816) | 1298816..1298882 | + | 67 | NuclAT_32 | - | - |
| - (1298816) | 1298816..1298882 | + | 67 | NuclAT_32 | - | - |
| - (1298816) | 1298816..1298882 | + | 67 | NuclAT_32 | - | - |
| - (1298816) | 1298816..1298882 | + | 67 | NuclAT_32 | - | - |
| - (1298816) | 1298816..1298882 | + | 67 | NuclAT_34 | - | - |
| - (1298816) | 1298816..1298882 | + | 67 | NuclAT_34 | - | - |
| - (1298816) | 1298816..1298882 | + | 67 | NuclAT_34 | - | - |
| - (1298816) | 1298816..1298882 | + | 67 | NuclAT_34 | - | - |
| - (1298816) | 1298816..1298882 | + | 67 | NuclAT_36 | - | - |
| - (1298816) | 1298816..1298882 | + | 67 | NuclAT_36 | - | - |
| - (1298816) | 1298816..1298882 | + | 67 | NuclAT_36 | - | - |
| - (1298816) | 1298816..1298882 | + | 67 | NuclAT_36 | - | - |
| QUD66_RS06155 (1299196) | 1299196..1299303 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1299356) | 1299356..1299417 | + | 62 | NuclAT_38 | - | - |
| - (1299356) | 1299356..1299417 | + | 62 | NuclAT_38 | - | - |
| - (1299356) | 1299356..1299417 | + | 62 | NuclAT_38 | - | - |
| - (1299356) | 1299356..1299417 | + | 62 | NuclAT_38 | - | - |
| - (1299356) | 1299356..1299417 | + | 62 | NuclAT_40 | - | - |
| - (1299356) | 1299356..1299417 | + | 62 | NuclAT_40 | - | - |
| - (1299356) | 1299356..1299417 | + | 62 | NuclAT_40 | - | - |
| - (1299356) | 1299356..1299417 | + | 62 | NuclAT_40 | - | - |
| - (1299356) | 1299356..1299417 | + | 62 | NuclAT_42 | - | - |
| - (1299356) | 1299356..1299417 | + | 62 | NuclAT_42 | - | - |
| - (1299356) | 1299356..1299417 | + | 62 | NuclAT_42 | - | - |
| - (1299356) | 1299356..1299417 | + | 62 | NuclAT_42 | - | - |
| - (1299356) | 1299356..1299418 | + | 63 | NuclAT_27 | - | - |
| - (1299356) | 1299356..1299418 | + | 63 | NuclAT_27 | - | - |
| - (1299356) | 1299356..1299418 | + | 63 | NuclAT_27 | - | - |
| - (1299356) | 1299356..1299418 | + | 63 | NuclAT_27 | - | - |
| - (1299356) | 1299356..1299418 | + | 63 | NuclAT_29 | - | - |
| - (1299356) | 1299356..1299418 | + | 63 | NuclAT_29 | - | - |
| - (1299356) | 1299356..1299418 | + | 63 | NuclAT_29 | - | - |
| - (1299356) | 1299356..1299418 | + | 63 | NuclAT_29 | - | - |
| - (1299356) | 1299356..1299418 | + | 63 | NuclAT_31 | - | - |
| - (1299356) | 1299356..1299418 | + | 63 | NuclAT_31 | - | - |
| - (1299356) | 1299356..1299418 | + | 63 | NuclAT_31 | - | - |
| - (1299356) | 1299356..1299418 | + | 63 | NuclAT_31 | - | - |
| - (1299356) | 1299356..1299418 | + | 63 | NuclAT_33 | - | - |
| - (1299356) | 1299356..1299418 | + | 63 | NuclAT_33 | - | - |
| - (1299356) | 1299356..1299418 | + | 63 | NuclAT_33 | - | - |
| - (1299356) | 1299356..1299418 | + | 63 | NuclAT_33 | - | - |
| - (1299356) | 1299356..1299418 | + | 63 | NuclAT_35 | - | - |
| - (1299356) | 1299356..1299418 | + | 63 | NuclAT_35 | - | - |
| - (1299356) | 1299356..1299418 | + | 63 | NuclAT_35 | - | - |
| - (1299356) | 1299356..1299418 | + | 63 | NuclAT_35 | - | - |
| - (1299356) | 1299356..1299418 | + | 63 | NuclAT_37 | - | - |
| - (1299356) | 1299356..1299418 | + | 63 | NuclAT_37 | - | - |
| - (1299356) | 1299356..1299418 | + | 63 | NuclAT_37 | - | - |
| - (1299356) | 1299356..1299418 | + | 63 | NuclAT_37 | - | - |
| - (1299356) | 1299356..1299419 | + | 64 | NuclAT_15 | - | - |
| - (1299356) | 1299356..1299419 | + | 64 | NuclAT_15 | - | - |
| - (1299356) | 1299356..1299419 | + | 64 | NuclAT_15 | - | - |
| - (1299356) | 1299356..1299419 | + | 64 | NuclAT_15 | - | - |
| - (1299356) | 1299356..1299419 | + | 64 | NuclAT_17 | - | - |
| - (1299356) | 1299356..1299419 | + | 64 | NuclAT_17 | - | - |
| - (1299356) | 1299356..1299419 | + | 64 | NuclAT_17 | - | - |
| - (1299356) | 1299356..1299419 | + | 64 | NuclAT_17 | - | - |
| - (1299356) | 1299356..1299419 | + | 64 | NuclAT_19 | - | - |
| - (1299356) | 1299356..1299419 | + | 64 | NuclAT_19 | - | - |
| - (1299356) | 1299356..1299419 | + | 64 | NuclAT_19 | - | - |
| - (1299356) | 1299356..1299419 | + | 64 | NuclAT_19 | - | - |
| - (1299356) | 1299356..1299419 | + | 64 | NuclAT_21 | - | - |
| - (1299356) | 1299356..1299419 | + | 64 | NuclAT_21 | - | - |
| - (1299356) | 1299356..1299419 | + | 64 | NuclAT_21 | - | - |
| - (1299356) | 1299356..1299419 | + | 64 | NuclAT_21 | - | - |
| - (1299356) | 1299356..1299419 | + | 64 | NuclAT_23 | - | - |
| - (1299356) | 1299356..1299419 | + | 64 | NuclAT_23 | - | - |
| - (1299356) | 1299356..1299419 | + | 64 | NuclAT_23 | - | - |
| - (1299356) | 1299356..1299419 | + | 64 | NuclAT_23 | - | - |
| - (1299356) | 1299356..1299419 | + | 64 | NuclAT_25 | - | - |
| - (1299356) | 1299356..1299419 | + | 64 | NuclAT_25 | - | - |
| - (1299356) | 1299356..1299419 | + | 64 | NuclAT_25 | - | - |
| - (1299356) | 1299356..1299419 | + | 64 | NuclAT_25 | - | - |
| QUD66_RS06160 (1299732) | 1299732..1299839 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (1299887) | 1299887..1299954 | + | 68 | NuclAT_14 | - | Antitoxin |
| - (1299887) | 1299887..1299954 | + | 68 | NuclAT_14 | - | Antitoxin |
| - (1299887) | 1299887..1299954 | + | 68 | NuclAT_14 | - | Antitoxin |
| - (1299887) | 1299887..1299954 | + | 68 | NuclAT_14 | - | Antitoxin |
| - (1299887) | 1299887..1299954 | + | 68 | NuclAT_16 | - | Antitoxin |
| - (1299887) | 1299887..1299954 | + | 68 | NuclAT_16 | - | Antitoxin |
| - (1299887) | 1299887..1299954 | + | 68 | NuclAT_16 | - | Antitoxin |
| - (1299887) | 1299887..1299954 | + | 68 | NuclAT_16 | - | Antitoxin |
| - (1299887) | 1299887..1299954 | + | 68 | NuclAT_18 | - | Antitoxin |
| - (1299887) | 1299887..1299954 | + | 68 | NuclAT_18 | - | Antitoxin |
| - (1299887) | 1299887..1299954 | + | 68 | NuclAT_18 | - | Antitoxin |
| - (1299887) | 1299887..1299954 | + | 68 | NuclAT_18 | - | Antitoxin |
| - (1299887) | 1299887..1299954 | + | 68 | NuclAT_20 | - | Antitoxin |
| - (1299887) | 1299887..1299954 | + | 68 | NuclAT_20 | - | Antitoxin |
| - (1299887) | 1299887..1299954 | + | 68 | NuclAT_20 | - | Antitoxin |
| - (1299887) | 1299887..1299954 | + | 68 | NuclAT_20 | - | Antitoxin |
| - (1299887) | 1299887..1299954 | + | 68 | NuclAT_22 | - | Antitoxin |
| - (1299887) | 1299887..1299954 | + | 68 | NuclAT_22 | - | Antitoxin |
| - (1299887) | 1299887..1299954 | + | 68 | NuclAT_22 | - | Antitoxin |
| - (1299887) | 1299887..1299954 | + | 68 | NuclAT_22 | - | Antitoxin |
| - (1299887) | 1299887..1299954 | + | 68 | NuclAT_24 | - | Antitoxin |
| - (1299887) | 1299887..1299954 | + | 68 | NuclAT_24 | - | Antitoxin |
| - (1299887) | 1299887..1299954 | + | 68 | NuclAT_24 | - | Antitoxin |
| - (1299887) | 1299887..1299954 | + | 68 | NuclAT_24 | - | Antitoxin |
| QUD66_RS06165 (1300244) | 1300244..1301344 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| QUD66_RS06170 (1301614) | 1301614..1301844 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| QUD66_RS06175 (1302002) | 1302002..1302697 | + | 696 | WP_001355927.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| QUD66_RS06180 (1302741) | 1302741..1303094 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| QUD66_RS06185 (1303279) | 1303279..1304673 | + | 1395 | WP_000086213.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T43050 WP_000170965.1 NZ_AP027156:c1299839-1299732 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T43050 NZ_AP027156:c1299839-1299732 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 68 bp
>AT43050 NZ_AP027156:1299887-1299954 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|