Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 1299732..1299954 Replicon chromosome
Accession NZ_AP027156
Organism Escherichia coli strain JNE181771

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag QUD66_RS06160 Protein ID WP_000170965.1
Coordinates 1299732..1299839 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 1299887..1299954 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QUD66_RS06130 (1295587) 1295587..1296420 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
QUD66_RS06135 (1296417) 1296417..1296809 + 393 WP_000200392.1 invasion regulator SirB2 -
QUD66_RS06140 (1296813) 1296813..1297622 + 810 WP_001257044.1 invasion regulator SirB1 -
QUD66_RS06145 (1297658) 1297658..1298512 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QUD66_RS06150 (1298661) 1298661..1298768 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1298818) 1298818..1298881 + 64 NuclAT_39 - -
- (1298818) 1298818..1298881 + 64 NuclAT_39 - -
- (1298818) 1298818..1298881 + 64 NuclAT_39 - -
- (1298818) 1298818..1298881 + 64 NuclAT_39 - -
- (1298818) 1298818..1298881 + 64 NuclAT_41 - -
- (1298818) 1298818..1298881 + 64 NuclAT_41 - -
- (1298818) 1298818..1298881 + 64 NuclAT_41 - -
- (1298818) 1298818..1298881 + 64 NuclAT_41 - -
- (1298818) 1298818..1298881 + 64 NuclAT_43 - -
- (1298818) 1298818..1298881 + 64 NuclAT_43 - -
- (1298818) 1298818..1298881 + 64 NuclAT_43 - -
- (1298818) 1298818..1298881 + 64 NuclAT_43 - -
- (1298816) 1298816..1298882 + 67 NuclAT_26 - -
- (1298816) 1298816..1298882 + 67 NuclAT_26 - -
- (1298816) 1298816..1298882 + 67 NuclAT_26 - -
- (1298816) 1298816..1298882 + 67 NuclAT_26 - -
- (1298816) 1298816..1298882 + 67 NuclAT_28 - -
- (1298816) 1298816..1298882 + 67 NuclAT_28 - -
- (1298816) 1298816..1298882 + 67 NuclAT_28 - -
- (1298816) 1298816..1298882 + 67 NuclAT_28 - -
- (1298816) 1298816..1298882 + 67 NuclAT_30 - -
- (1298816) 1298816..1298882 + 67 NuclAT_30 - -
- (1298816) 1298816..1298882 + 67 NuclAT_30 - -
- (1298816) 1298816..1298882 + 67 NuclAT_30 - -
- (1298816) 1298816..1298882 + 67 NuclAT_32 - -
- (1298816) 1298816..1298882 + 67 NuclAT_32 - -
- (1298816) 1298816..1298882 + 67 NuclAT_32 - -
- (1298816) 1298816..1298882 + 67 NuclAT_32 - -
- (1298816) 1298816..1298882 + 67 NuclAT_34 - -
- (1298816) 1298816..1298882 + 67 NuclAT_34 - -
- (1298816) 1298816..1298882 + 67 NuclAT_34 - -
- (1298816) 1298816..1298882 + 67 NuclAT_34 - -
- (1298816) 1298816..1298882 + 67 NuclAT_36 - -
- (1298816) 1298816..1298882 + 67 NuclAT_36 - -
- (1298816) 1298816..1298882 + 67 NuclAT_36 - -
- (1298816) 1298816..1298882 + 67 NuclAT_36 - -
QUD66_RS06155 (1299196) 1299196..1299303 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1299356) 1299356..1299417 + 62 NuclAT_38 - -
- (1299356) 1299356..1299417 + 62 NuclAT_38 - -
- (1299356) 1299356..1299417 + 62 NuclAT_38 - -
- (1299356) 1299356..1299417 + 62 NuclAT_38 - -
- (1299356) 1299356..1299417 + 62 NuclAT_40 - -
- (1299356) 1299356..1299417 + 62 NuclAT_40 - -
- (1299356) 1299356..1299417 + 62 NuclAT_40 - -
- (1299356) 1299356..1299417 + 62 NuclAT_40 - -
- (1299356) 1299356..1299417 + 62 NuclAT_42 - -
- (1299356) 1299356..1299417 + 62 NuclAT_42 - -
- (1299356) 1299356..1299417 + 62 NuclAT_42 - -
- (1299356) 1299356..1299417 + 62 NuclAT_42 - -
- (1299356) 1299356..1299418 + 63 NuclAT_27 - -
- (1299356) 1299356..1299418 + 63 NuclAT_27 - -
- (1299356) 1299356..1299418 + 63 NuclAT_27 - -
- (1299356) 1299356..1299418 + 63 NuclAT_27 - -
- (1299356) 1299356..1299418 + 63 NuclAT_29 - -
- (1299356) 1299356..1299418 + 63 NuclAT_29 - -
- (1299356) 1299356..1299418 + 63 NuclAT_29 - -
- (1299356) 1299356..1299418 + 63 NuclAT_29 - -
- (1299356) 1299356..1299418 + 63 NuclAT_31 - -
- (1299356) 1299356..1299418 + 63 NuclAT_31 - -
- (1299356) 1299356..1299418 + 63 NuclAT_31 - -
- (1299356) 1299356..1299418 + 63 NuclAT_31 - -
- (1299356) 1299356..1299418 + 63 NuclAT_33 - -
- (1299356) 1299356..1299418 + 63 NuclAT_33 - -
- (1299356) 1299356..1299418 + 63 NuclAT_33 - -
- (1299356) 1299356..1299418 + 63 NuclAT_33 - -
- (1299356) 1299356..1299418 + 63 NuclAT_35 - -
- (1299356) 1299356..1299418 + 63 NuclAT_35 - -
- (1299356) 1299356..1299418 + 63 NuclAT_35 - -
- (1299356) 1299356..1299418 + 63 NuclAT_35 - -
- (1299356) 1299356..1299418 + 63 NuclAT_37 - -
- (1299356) 1299356..1299418 + 63 NuclAT_37 - -
- (1299356) 1299356..1299418 + 63 NuclAT_37 - -
- (1299356) 1299356..1299418 + 63 NuclAT_37 - -
- (1299356) 1299356..1299419 + 64 NuclAT_15 - -
- (1299356) 1299356..1299419 + 64 NuclAT_15 - -
- (1299356) 1299356..1299419 + 64 NuclAT_15 - -
- (1299356) 1299356..1299419 + 64 NuclAT_15 - -
- (1299356) 1299356..1299419 + 64 NuclAT_17 - -
- (1299356) 1299356..1299419 + 64 NuclAT_17 - -
- (1299356) 1299356..1299419 + 64 NuclAT_17 - -
- (1299356) 1299356..1299419 + 64 NuclAT_17 - -
- (1299356) 1299356..1299419 + 64 NuclAT_19 - -
- (1299356) 1299356..1299419 + 64 NuclAT_19 - -
- (1299356) 1299356..1299419 + 64 NuclAT_19 - -
- (1299356) 1299356..1299419 + 64 NuclAT_19 - -
- (1299356) 1299356..1299419 + 64 NuclAT_21 - -
- (1299356) 1299356..1299419 + 64 NuclAT_21 - -
- (1299356) 1299356..1299419 + 64 NuclAT_21 - -
- (1299356) 1299356..1299419 + 64 NuclAT_21 - -
- (1299356) 1299356..1299419 + 64 NuclAT_23 - -
- (1299356) 1299356..1299419 + 64 NuclAT_23 - -
- (1299356) 1299356..1299419 + 64 NuclAT_23 - -
- (1299356) 1299356..1299419 + 64 NuclAT_23 - -
- (1299356) 1299356..1299419 + 64 NuclAT_25 - -
- (1299356) 1299356..1299419 + 64 NuclAT_25 - -
- (1299356) 1299356..1299419 + 64 NuclAT_25 - -
- (1299356) 1299356..1299419 + 64 NuclAT_25 - -
QUD66_RS06160 (1299732) 1299732..1299839 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1299887) 1299887..1299954 + 68 NuclAT_14 - Antitoxin
- (1299887) 1299887..1299954 + 68 NuclAT_14 - Antitoxin
- (1299887) 1299887..1299954 + 68 NuclAT_14 - Antitoxin
- (1299887) 1299887..1299954 + 68 NuclAT_14 - Antitoxin
- (1299887) 1299887..1299954 + 68 NuclAT_16 - Antitoxin
- (1299887) 1299887..1299954 + 68 NuclAT_16 - Antitoxin
- (1299887) 1299887..1299954 + 68 NuclAT_16 - Antitoxin
- (1299887) 1299887..1299954 + 68 NuclAT_16 - Antitoxin
- (1299887) 1299887..1299954 + 68 NuclAT_18 - Antitoxin
- (1299887) 1299887..1299954 + 68 NuclAT_18 - Antitoxin
- (1299887) 1299887..1299954 + 68 NuclAT_18 - Antitoxin
- (1299887) 1299887..1299954 + 68 NuclAT_18 - Antitoxin
- (1299887) 1299887..1299954 + 68 NuclAT_20 - Antitoxin
- (1299887) 1299887..1299954 + 68 NuclAT_20 - Antitoxin
- (1299887) 1299887..1299954 + 68 NuclAT_20 - Antitoxin
- (1299887) 1299887..1299954 + 68 NuclAT_20 - Antitoxin
- (1299887) 1299887..1299954 + 68 NuclAT_22 - Antitoxin
- (1299887) 1299887..1299954 + 68 NuclAT_22 - Antitoxin
- (1299887) 1299887..1299954 + 68 NuclAT_22 - Antitoxin
- (1299887) 1299887..1299954 + 68 NuclAT_22 - Antitoxin
- (1299887) 1299887..1299954 + 68 NuclAT_24 - Antitoxin
- (1299887) 1299887..1299954 + 68 NuclAT_24 - Antitoxin
- (1299887) 1299887..1299954 + 68 NuclAT_24 - Antitoxin
- (1299887) 1299887..1299954 + 68 NuclAT_24 - Antitoxin
QUD66_RS06165 (1300244) 1300244..1301344 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
QUD66_RS06170 (1301614) 1301614..1301844 + 231 WP_001146442.1 putative cation transport regulator ChaB -
QUD66_RS06175 (1302002) 1302002..1302697 + 696 WP_001355927.1 glutathione-specific gamma-glutamylcyclotransferase -
QUD66_RS06180 (1302741) 1302741..1303094 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
QUD66_RS06185 (1303279) 1303279..1304673 + 1395 WP_000086213.1 inverse autotransporter invasin YchO -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T43050 WP_000170965.1 NZ_AP027156:c1299839-1299732 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T43050 NZ_AP027156:c1299839-1299732 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT43050 NZ_AP027156:1299887-1299954 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029


Antitoxin

Download structure file

References