Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2623908..2624244 | Replicon | chromosome |
Accession | NZ_AP027136 | ||
Organism | Enterococcus faecalis strain JARB-HU0796 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A1J6YG70 |
Locus tag | QUD94_RS12620 | Protein ID | WP_002396786.1 |
Coordinates | 2623908..2624051 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2624195..2624244 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QUD94_RS12600 (2619186) | 2619186..2619401 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
QUD94_RS12605 (2619540) | 2619540..2620532 | + | 993 | WP_002394775.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
QUD94_RS12610 (2620699) | 2620699..2621337 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
QUD94_RS12615 (2622022) | 2622022..2623638 | + | 1617 | WP_010710855.1 | phosphatase PAP2/LCP family protein | - |
- (2623722) | 2623722..2623797 | - | 76 | NuclAT_6 | - | - |
- (2623695) | 2623695..2623811 | - | 117 | NuclAT_8 | - | - |
QUD94_RS12620 (2623908) | 2623908..2624051 | + | 144 | WP_002396786.1 | putative holin-like toxin | Toxin |
- (2624195) | 2624195..2624244 | + | 50 | NuclAT_7 | - | Antitoxin |
- (2623983) | 2623983..2624245 | - | 263 | NuclAT_5 | - | - |
QUD94_RS12625 (2624246) | 2624246..2628937 | - | 4692 | WP_010710853.1 | WxL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5203.19 Da Isoelectric Point: 8.6626
>T43027 WP_002396786.1 NZ_AP027136:2623908-2624051 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
Download Length: 144 bp
>T43027 NZ_AP027136:2623908-2624051 [Enterococcus faecalis]
ATGAATGTAAGTACTAAAATCTATGAAAGGAGAGGCCTTTTGTCTATCGCAGAAGCTTTAGCTCTGATGATTAGTTTCGG
TTCTTTTATCGCAACGTTAATCTTCGGAATCCTAGAGGCTGTTAAAGAAGACAATAAAAAATAA
ATGAATGTAAGTACTAAAATCTATGAAAGGAGAGGCCTTTTGTCTATCGCAGAAGCTTTAGCTCTGATGATTAGTTTCGG
TTCTTTTATCGCAACGTTAATCTTCGGAATCCTAGAGGCTGTTAAAGAAGACAATAAAAAATAA
Antitoxin
Download Length: 50 bp
>AT43027 NZ_AP027136:2624195-2624244 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|