Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2486537..2486721 | Replicon | chromosome |
| Accession | NZ_AP027135 | ||
| Organism | Staphylococcus aureus strain JP089 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
| Locus tag | QMM73_RS12470 | Protein ID | WP_000482652.1 |
| Coordinates | 2486614..2486721 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2486537..2486597 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMM73_RS12455 | 2481992..2482123 | - | 132 | WP_223223631.1 | hypothetical protein | - |
| QMM73_RS12460 | 2482390..2484123 | - | 1734 | WP_061838872.1 | ABC transporter ATP-binding protein | - |
| QMM73_RS12465 | 2484148..2485911 | - | 1764 | WP_061838873.1 | ABC transporter ATP-binding protein | - |
| - | 2486537..2486597 | + | 61 | - | - | Antitoxin |
| QMM73_RS12470 | 2486614..2486721 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| QMM73_RS12475 | 2486855..2487241 | - | 387 | WP_000779360.1 | flippase GtxA | - |
| QMM73_RS12480 | 2487509..2488651 | + | 1143 | WP_061838874.1 | glycerate kinase | - |
| QMM73_RS12485 | 2488711..2489364 | + | 654 | WP_053012342.1 | hypothetical protein | - |
| QMM73_RS12490 | 2489546..2490757 | + | 1212 | WP_061838875.1 | multidrug effflux MFS transporter | - |
| QMM73_RS12495 | 2490880..2491353 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | sbi / hlgA / hlgA / hlgC / hlgB | 2469790..2487241 | 17451 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T43007 WP_000482652.1 NZ_AP027135:c2486721-2486614 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T43007 NZ_AP027135:c2486721-2486614 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT43007 NZ_AP027135:2486537-2486597 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|