Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2197276..2197492 | Replicon | chromosome |
Accession | NZ_AP027135 | ||
Organism | Staphylococcus aureus strain JP089 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | QMM73_RS10975 | Protein ID | WP_001802298.1 |
Coordinates | 2197388..2197492 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2197276..2197331 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QMM73_RS10950 | 2193473..2194138 | - | 666 | WP_001024089.1 | SDR family oxidoreductase | - |
QMM73_RS10955 | 2194290..2194610 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
QMM73_RS10960 | 2194612..2195589 | + | 978 | WP_000019734.1 | CDF family zinc efflux transporter CzrB | - |
QMM73_RS10965 | 2195855..2196946 | + | 1092 | WP_061838836.1 | hypothetical protein | - |
- | 2197276..2197331 | + | 56 | - | - | Antitoxin |
QMM73_RS10975 | 2197388..2197492 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
QMM73_RS10980 | 2198172..2198330 | + | 159 | WP_001792784.1 | hypothetical protein | - |
QMM73_RS10985 | 2198988..2199845 | - | 858 | WP_000370924.1 | HAD family hydrolase | - |
QMM73_RS10990 | 2199913..2200695 | - | 783 | WP_061838837.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T43004 WP_001802298.1 NZ_AP027135:c2197492-2197388 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T43004 NZ_AP027135:c2197492-2197388 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT43004 NZ_AP027135:2197276-2197331 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|