Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2476394..2476578 | Replicon | chromosome |
| Accession | NZ_AP027134 | ||
| Organism | Staphylococcus aureus strain JP008 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | QMM94_RS12325 | Protein ID | WP_000482647.1 |
| Coordinates | 2476471..2476578 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2476394..2476454 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMM94_RS12300 | 2471946..2473061 | - | 1116 | WP_154283952.1 | pyridoxal phosphate-dependent aminotransferase family protein | - |
| QMM94_RS12305 | 2473039..2474046 | - | 1008 | WP_001046645.1 | biotin synthase BioB | - |
| QMM94_RS12310 | 2474048..2475406 | - | 1359 | WP_154283953.1 | adenosylmethionine--8-amino-7-oxononanoate transaminase | - |
| QMM94_RS12315 | 2475384..2476070 | - | 687 | WP_154283954.1 | dethiobiotin synthase | - |
| QMM94_RS12320 | 2476125..2476292 | - | 168 | WP_281961878.1 | hypothetical protein | - |
| - | 2476394..2476454 | + | 61 | - | - | Antitoxin |
| QMM94_RS12325 | 2476471..2476578 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| QMM94_RS12330 | 2476712..2477098 | - | 387 | WP_000779356.1 | flippase GtxA | - |
| QMM94_RS12335 | 2477366..2478508 | + | 1143 | WP_154283957.1 | glycerate kinase | - |
| QMM94_RS12340 | 2478568..2479227 | + | 660 | WP_000831298.1 | membrane protein | - |
| QMM94_RS12345 | 2479408..2480619 | + | 1212 | WP_154283958.1 | multidrug effflux MFS transporter | - |
| QMM94_RS12350 | 2480742..2481215 | - | 474 | WP_154283959.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T42992 WP_000482647.1 NZ_AP027134:c2476578-2476471 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T42992 NZ_AP027134:c2476578-2476471 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT42992 NZ_AP027134:2476394-2476454 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTATTGCCCTAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTATTGCCCTAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|