Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2015388..2015687 | Replicon | chromosome |
| Accession | NZ_AP027134 | ||
| Organism | Staphylococcus aureus strain JP008 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | QMM94_RS09840 | Protein ID | WP_011447039.1 |
| Coordinates | 2015511..2015687 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2015388..2015443 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMM94_RS09800 | 2010719..2010979 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| QMM94_RS09805 | 2011032..2011382 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| QMM94_RS09810 | 2012067..2012516 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| QMM94_RS09815 | 2012611..2012946 | - | 336 | Protein_1894 | SH3 domain-containing protein | - |
| QMM94_RS09820 | 2013596..2014087 | - | 492 | WP_000919350.1 | staphylokinase | - |
| QMM94_RS09825 | 2014278..2015033 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| QMM94_RS09830 | 2015045..2015299 | - | 255 | WP_000611512.1 | phage holin | - |
| QMM94_RS09835 | 2015351..2015458 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 2015380..2015519 | + | 140 | NuclAT_0 | - | - |
| - | 2015380..2015519 | + | 140 | NuclAT_0 | - | - |
| - | 2015380..2015519 | + | 140 | NuclAT_0 | - | - |
| - | 2015380..2015519 | + | 140 | NuclAT_0 | - | - |
| - | 2015388..2015443 | + | 56 | - | - | Antitoxin |
| QMM94_RS09840 | 2015511..2015687 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| QMM94_RS09845 | 2015837..2016133 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| QMM94_RS09850 | 2016191..2016478 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| QMM94_RS09855 | 2016525..2016677 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| QMM94_RS09860 | 2016667..2020452 | - | 3786 | WP_281961837.1 | phage tail spike protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | blaZ | map / hlb / scn / chp / sak / hlb / groEL / hld | 1963260..2076765 | 113505 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T42985 WP_011447039.1 NZ_AP027134:c2015687-2015511 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T42985 NZ_AP027134:c2015687-2015511 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT42985 NZ_AP027134:2015388-2015443 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|