Detailed information of TA system TA042831

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 62928..63197
• Replicon: plasmid pMY732-1
• Accession: NZ_AP026908
• Organism: Escherichia coli strain MY732

Toxin (Protein)

• Gene name: hok
• Uniprot ID: G9G195
• Locus tag: MY015_RS24495
• Protein ID: WP_001323520.1
• Coordinates: 63081..63197 (+)
• Length: 39 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	62928..62993 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
MY015_RS24455 (57982)	57982..58248	+	267	WP_072254135.1	hypothetical protein	-
MY015_RS24460 (58721)	58721..59248	+	528	WP_000290793.1	single-stranded DNA-binding protein	-
MY015_RS24465 (59304)	59304..59537	+	234	WP_000006004.1	DUF905 domain-containing protein	-
MY015_RS24470 (59596)	59596..61554	+	1959	WP_001145469.1	ParB/RepB/Spo0J family partition protein	-
MY015_RS24475 (61609)	61609..62043	+	435	WP_000845895.1	conjugation system SOS inhibitor PsiB	-
MY015_RS24480 (62040)	62040..62802	+	763	Protein_65	plasmid SOS inhibition protein A	-
MY015_RS24485 (62771)	62771..62959	-	189	WP_001299721.1	hypothetical protein	-
- (62927)	62927..62990	-	64	NuclAT_1	-	-
- (62927)	62927..62990	-	64	NuclAT_1	-	-
- (62928)	62928..62993	+	66	NuclAT_0	-	Antitoxin
- (62928)	62928..62993	+	66	NuclAT_0	-	Antitoxin
- (62928)	62928..62993	+	66	NuclAT_1	-	Antitoxin
- (62771)	62771..62995	+	225	NuclAT_0	-	-
- (62771)	62771..62995	+	225	NuclAT_0	-	-
- (62771)	62771..62995	+	225	NuclAT_0	-	-
- (62771)	62771..62995	+	225	NuclAT_0	-	-
- (62771)	62771..62995	-	225	NuclAT_0	-	-
MY015_RS24490 (62981)	62981..63130	+	150	Protein_67	plasmid maintenance protein Mok	-
MY015_RS24495 (63081)	63081..63197	+	117	WP_001323520.1	type I toxin-antitoxin system Hok family toxin	Toxin
MY015_RS24500 (63417)	63417..63647	+	231	WP_001426396.1	hypothetical protein	-
MY015_RS24505 (63645)	63645..63818	-	174	Protein_70	hypothetical protein	-
MY015_RS24510 (63888)	63888..64094	+	207	WP_000547939.1	hypothetical protein	-
MY015_RS24515 (64119)	64119..64406	+	288	WP_265163830.1	hypothetical protein	-
MY015_RS24520 (64528)	64528..65349	+	822	WP_001234469.1	DUF932 domain-containing protein	-
MY015_RS24525 (65646)	65646..66293	-	648	WP_000614936.1	transglycosylase SLT domain-containing protein	-
MY015_RS24530 (66570)	66570..66953	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
MY015_RS24535 (67247)	67247..67944	+	698	WP_095033700.1	IS1-like element IS1B family transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (1-34)

Sequences

Toxin

Protein

• Length: 39 a.a.
• Molecular weight: 4455.23 Da
• Isoelectric Point: 8.5110

>T42831 WP_001323520.1 NZ_AP026908:63081-63197 [Escherichia coli]
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 117 bp

>T42831 NZ_AP026908:63081-63197 [Escherichia coli]
GTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGA
GGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT42831 NZ_AP026908:62928-62993 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC

Structures

Toxin

• AlphaFold DB: G9G195

Antitoxin