Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 62928..63197 | Replicon | plasmid pMY732-1 |
| Accession | NZ_AP026908 | ||
| Organism | Escherichia coli strain MY732 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | G9G195 |
| Locus tag | MY015_RS24495 | Protein ID | WP_001323520.1 |
| Coordinates | 63081..63197 (+) | Length | 39 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 62928..62993 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MY015_RS24455 (57982) | 57982..58248 | + | 267 | WP_072254135.1 | hypothetical protein | - |
| MY015_RS24460 (58721) | 58721..59248 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
| MY015_RS24465 (59304) | 59304..59537 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
| MY015_RS24470 (59596) | 59596..61554 | + | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
| MY015_RS24475 (61609) | 61609..62043 | + | 435 | WP_000845895.1 | conjugation system SOS inhibitor PsiB | - |
| MY015_RS24480 (62040) | 62040..62802 | + | 763 | Protein_65 | plasmid SOS inhibition protein A | - |
| MY015_RS24485 (62771) | 62771..62959 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - (62927) | 62927..62990 | - | 64 | NuclAT_1 | - | - |
| - (62927) | 62927..62990 | - | 64 | NuclAT_1 | - | - |
| - (62928) | 62928..62993 | + | 66 | NuclAT_0 | - | Antitoxin |
| - (62928) | 62928..62993 | + | 66 | NuclAT_0 | - | Antitoxin |
| - (62928) | 62928..62993 | + | 66 | NuclAT_1 | - | Antitoxin |
| - (62771) | 62771..62995 | + | 225 | NuclAT_0 | - | - |
| - (62771) | 62771..62995 | + | 225 | NuclAT_0 | - | - |
| - (62771) | 62771..62995 | + | 225 | NuclAT_0 | - | - |
| - (62771) | 62771..62995 | + | 225 | NuclAT_0 | - | - |
| - (62771) | 62771..62995 | - | 225 | NuclAT_0 | - | - |
| MY015_RS24490 (62981) | 62981..63130 | + | 150 | Protein_67 | plasmid maintenance protein Mok | - |
| MY015_RS24495 (63081) | 63081..63197 | + | 117 | WP_001323520.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| MY015_RS24500 (63417) | 63417..63647 | + | 231 | WP_001426396.1 | hypothetical protein | - |
| MY015_RS24505 (63645) | 63645..63818 | - | 174 | Protein_70 | hypothetical protein | - |
| MY015_RS24510 (63888) | 63888..64094 | + | 207 | WP_000547939.1 | hypothetical protein | - |
| MY015_RS24515 (64119) | 64119..64406 | + | 288 | WP_265163830.1 | hypothetical protein | - |
| MY015_RS24520 (64528) | 64528..65349 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| MY015_RS24525 (65646) | 65646..66293 | - | 648 | WP_000614936.1 | transglycosylase SLT domain-containing protein | - |
| MY015_RS24530 (66570) | 66570..66953 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| MY015_RS24535 (67247) | 67247..67944 | + | 698 | WP_095033700.1 | IS1-like element IS1B family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4455.23 Da Isoelectric Point: 8.5110
>T42831 WP_001323520.1 NZ_AP026908:63081-63197 [Escherichia coli]
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 117 bp
>T42831 NZ_AP026908:63081-63197 [Escherichia coli]
GTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGA
GGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
GTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGA
GGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT42831 NZ_AP026908:62928-62993 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|