Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 43525..43854 | Replicon | plasmid pIPCEC48_1 |
| Accession | NZ_AP026795 | ||
| Organism | Escherichia coli strain IPCEC48 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | OPA53_RS25720 | Protein ID | WP_001372321.1 |
| Coordinates | 43525..43650 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 43727..43854 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OPA53_RS25675 (38638) | 38638..38865 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
| OPA53_RS25680 (38953) | 38953..39630 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| OPA53_RS25685 (39764) | 39764..40147 | - | 384 | WP_001151566.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| OPA53_RS25690 (40477) | 40477..41079 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| OPA53_RS25695 (41376) | 41376..42197 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| OPA53_RS25700 (42316) | 42316..42603 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| OPA53_RS25705 (42628) | 42628..42834 | - | 207 | WP_000275859.1 | hypothetical protein | - |
| OPA53_RS25710 (42904) | 42904..43077 | + | 174 | Protein_53 | hypothetical protein | - |
| OPA53_RS25715 (43075) | 43075..43305 | - | 231 | WP_001426396.1 | hypothetical protein | - |
| OPA53_RS25720 (43525) | 43525..43650 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| OPA53_RS25725 (43592) | 43592..43741 | - | 150 | Protein_56 | plasmid maintenance protein Mok | - |
| - (43727) | 43727..43854 | - | 128 | NuclAT_0 | - | Antitoxin |
| - (43727) | 43727..43854 | - | 128 | NuclAT_0 | - | Antitoxin |
| - (43727) | 43727..43854 | - | 128 | NuclAT_0 | - | Antitoxin |
| - (43727) | 43727..43854 | - | 128 | NuclAT_0 | - | Antitoxin |
| - (45296) | 45296..45398 | - | 103 | NuclAT_1 | - | - |
| - (45296) | 45296..45398 | - | 103 | NuclAT_1 | - | - |
| - (45296) | 45296..45398 | - | 103 | NuclAT_1 | - | - |
| - (45296) | 45296..45398 | - | 103 | NuclAT_1 | - | - |
| OPA53_RS25735 (45367) | 45367..46129 | - | 763 | Protein_58 | plasmid SOS inhibition protein A | - |
| OPA53_RS25740 (46126) | 46126..46560 | - | 435 | WP_000845949.1 | conjugation system SOS inhibitor PsiB | - |
| OPA53_RS25745 (46615) | 46615..48573 | - | 1959 | WP_042045562.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr | senB | 1..165477 | 165477 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T42750 WP_001372321.1 NZ_AP026795:c43650-43525 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T42750 NZ_AP026795:c43650-43525 [Escherichia coli]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 128 bp
>AT42750 NZ_AP026795:c43854-43727 [Escherichia coli]
CGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAA
GTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
CGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAA
GTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|